• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002701 Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_002701.5, 553727227
Length 1430 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 1, mRNA.
Product POU domain, class 5, transcription factor 1 isoform 1
Comment

Summary: This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate in a translocation with the Ewing's sarcoma gene on chromosome 21, which also leads to tumor formation. Alternative splicing, as well as usage of alternative AUG and non-AUG translation initiation codons, results in multiple isoforms. One of the AUG start codons is polymorphic in human populations. Related pseudogenes have been identified on chromosomes 1, 3, 8, 10, and 12. [provided by RefSeq, Oct 2013].


Transcript Variant: This variant (1, also known as OCT4A) represents the shortest transcript and encodes the longest isoform (1).

RefSeq NP_002692.2
CDS 74..1156
Misc Feature(1)11..13
Misc Feature(2)11..13
Misc Feature(3)404..406
Misc Feature(4)404..406
Misc Feature(5)485..709
Misc Feature(6)764..940
Misc Feature(7)order(764..778,782..784,833..835,851..853,890..892,
Misc Feature(8)order(770..772,779..781,899..901,908..913,920..922)
Misc Feature(9)776..778
Misc Feature(10)779..781
Misc Feature(11)938..940
Misc Feature(12)941..943
Misc Feature(13)1136..1138
Exon (1)1..478
Gene:POU5F1
Gene Synonym:Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
Exon (2)479..599
Gene:POU5F1
Gene Synonym:Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
Exon (3)600..730
Gene:POU5F1
Gene Synonym:Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
Exon (4)731..889
Gene:POU5F1
Gene Synonym:Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
Exon (5)890..1420
Gene:POU5F1
Gene Synonym:Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
Translation MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGI PPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPG AVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFS QTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENR VRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(60)-g, adbSNP:192146552
94+a, gdbSNP:2077010
100+c, tdbSNP:1265160
complement(136)-t, cdbSNP:117585298
complement(149)-t, cdbSNP:267600952
complement(160)-c, adbSNP:200769740
complement(161)-t, cdbSNP:41257954
complement(267)-g, adbSNP:77172244
complement(270)-g, adbSNP:374685641
complement(314)-t, cdbSNP:370690490
complement(337)-g, adbSNP:201790772
364+c, tdbSNP:1062630
complement(370)-t, adbSNP:141749005
complement(372)-c, adbSNP:138735965
complement(394)-g, adbSNP:187901814
complement(422)-t, cdbSNP:182726472
complement(426)-g, adbSNP:144901157
complement(495)-dbSNP:
complement(495)-g, adbSNP:149025884
complement(498)-g, adbSNP:137936040
complement(517)-t, cdbSNP:150320288
complement(619)-dbSNP:
complement(619)-t, cdbSNP:373808092
complement(673)-c, adbSNP:115234511
complement(749)-dbSNP:
complement(749)-t, cdbSNP:111154800
complement(749)-t, cdbSNP:386518570
749+c, tdbSNP:1150767
complement(793)-t, adbSNP:368434272
complement(838)-g, cdbSNP:17851818
complement(943)-dbSNP:
complement(943)-g, adbSNP:141766253
1120+c, tdbSNP:1061118
1125+c, tdbSNP:1061120
1212+a, gdbSNP:1061126
complement(1231)-t, cdbSNP:3734864
complement(1282..1283)-, ttdbSNP:60004964
complement(1282)-t, gdbSNP:200275741
1394+c, tdbSNP:13409
Gene SymbolPOU5F1
Gene SynonymOct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
Chromosome6
Locus Map6p21.31
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002701 Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 1, mRNA. In-stock $418.00 $369.00 10
NM_001173531 Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 3, mRNA. In-stock $308.00 $259.00 10
NM_001285987 Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 5, mRNA. On-demand $449.00 14
NM_001285986 Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 4, mRNA. On-demand $399.00 14
NM_203289 Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 2, mRNA. In-stock $308.00 $259.00 10
Title An expressed retrogene of the master embryonic stem cell gene POU5F1 is associated with prostate cancer susceptibility .
Author Breyer JP, Dorset DC, Clark TA, Bradley KM, Wahlfors TA, McReynolds KM, Maynard WH, Chang SS, Cookson MS, Smith JA, Schleutker J, Dupont WD and Smith JR.
Journal Am. J. Hum. Genet. 94 (3), 395-404 (2014)
Title Suppression of OCT4B enhances sensitivity of lung adenocarcinoma A549 cells to cisplatin via increased apoptosis .
Author Cortes-Dericks L, Yazd EF, Mowla SJ, Schmid RA and Karoubi G.
Journal Anticancer Res. 33 (12), 5365-5373 (2013)
Title Concise review: isoforms of OCT4 contribute to the confusing diversity in stem cell biology .
Author Wang X and Dai J.
Journal Stem Cells 28 (5), 885-893 (2010)
Title Mapping of the minimal internal ribosome entry site element in the human embryonic stem cell gene OCT4B mRNA .
Author Zhang W, Wang X, Xiao Z, Liu W, Chen B and Dai J.
Journal Biochem. Biophys. Res. Commun. 394 (3), 750-754 (2010)
Title Alternative translation of OCT4 by an internal ribosome entry site and its novel function in stress response .
Author Wang X, Zhao Y, Xiao Z, Chen B, Wei Z, Wang B, Zhang J, Han J, Gao Y, Li L, Zhao H, Zhao W, Lin H and Dai J.
Journal Stem Cells 27 (6), 1265-1275 (2009)
Title OCT4 spliced variants are differentially expressed in human pluripotent and nonpluripotent cells .
Author Atlasi Y, Mowla SJ, Ziaee SA, Gokhale PJ and Andrews PW.
Journal Stem Cells 26 (12), 3068-3074 (2008)
Title The human OCT-4 isoforms differ in their ability to confer self-renewal .
Author Lee J, Kim HK, Rho JY, Han YM and Kim J.
Journal J. Biol. Chem. 281 (44), 33554-33565 (2006)
Title A human POU domain gene, mPOU, is expressed in developing brain and specific adult tissues .
Author Wey E, Lyons GE and Schafer BW.
Journal Eur. J. Biochem. 220 (3), 753-762 (1994)
Title Human Oct3 gene family: cDNA sequences, alternative splicing, gene organization, chromosomal location, and expression at low levels in adult tissues .
Author Takeda J, Seino S and Bell GI.
Journal Nucleic Acids Res. 20 (17), 4613-4620 (1992)
Title Octamer-dependent regulation of the kFGF gene in embryonal carcinoma and embryonic stem cells .
Author Schoorlemmer J and Kruijer W.
Journal Mech. Dev. 36 (1-2), 75-86 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.