• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_002701 Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 1, mRNA. ORF Sequence $314.07
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002701.4, 116235483
Length 1411 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 1, mRNA.
Product POU domain, class 5, transcription factor 1 isoform 1
Comment

Summary: This gene encodes a transcription factor containing a POU homeodomain. This transcription factor plays a role in embryonic development, especially during early embryogenesis, and it is necessary for embryonic stem cell pluripotency. A translocation of this gene with the Ewing's sarcoma gene, t(6;22)(p21;q12), has been linked to tumor formation. Alternative splicing, as well as usage of alternative translation initiation codons, results in multiple isoforms, one of which initiates at a non-AUG (CUG) start codon. Related pseudogenes have been identified on chromosomes 1, 3, 8, 10, and 12. [provided by RefSeq, Mar 2010].


Transcript Variant: This variant (1) encodes the longer isoform (1, also known as OCT4A).

RefSeq NP_002692.2
CDS 55..1137
Misc Feature(1)466..690
Misc Feature(2)466..690
Misc Feature(3)745..921
Misc Feature(4)order(745..759,763..765,814..816,832..834,871..873,
Misc Feature(5)order(751..753,760..762,880..882,889..894,901..903)
Exon (1)460..580
Gene:POU5F1
Gene Synonym:Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
Exon (2)581..711
Gene:POU5F1
Gene Synonym:Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
Exon (3)712..870
Gene:POU5F1
Gene Synonym:Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
Exon (4)871..1401
Gene:POU5F1
Gene Synonym:Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
Translation MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGI PPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPG AVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFS QTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENR VRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(41)-dbSNP:
complement(41)-g, adbSNP:192146552
complement(75)-g, adbSNP:2077010
complement(81)-t, cdbSNP:1265160
complement(117)-t, cdbSNP:117585298
complement(141)-c, adbSNP:200769740
complement(142)-t, cdbSNP:41257954
complement(248)-g, adbSNP:77172244
complement(318)-g, adbSNP:201790772
complement(345)-t, cdbSNP:1062630
complement(351)-t, cdbSNP:141749005
complement(353)-c, adbSNP:138735965
complement(375)-g, adbSNP:187901814
complement(403)-t, cdbSNP:182726472
complement(407)-g, adbSNP:144901157
complement(476)-dbSNP:
complement(476)-g, adbSNP:149025884
complement(479)-g, adbSNP:137936040
complement(498)-t, cdbSNP:150320288
complement(654)-dbSNP:
complement(654)-c, adbSNP:115234511
complement(730)-dbSNP:
complement(730)-t, cdbSNP:1150767
complement(819)-g, cdbSNP:17851818
complement(865)-t, cdbSNP:145506070
complement(924)-dbSNP:
complement(924)-g, adbSNP:141766253
complement(1101)-t, cdbSNP:1061118
complement(1106)-t, cdbSNP:1061120
complement(1193)-g, adbSNP:1061126
complement(1212)-t, cdbSNP:3734864
complement(1263..1264)-, ttdbSNP:60004964
complement(1263)-t, gdbSNP:200275741
complement(1375)-t, cdbSNP:13409
Gene SymbolPOU5F1
Gene SynonymOct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
Chromosome6
Locus Map6p21.31
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001173531 Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 3, mRNA. Full Length $364.53
ORF Sequence $166.17
NM_002701 Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 1, mRNA. Full Length $409.19
ORF Sequence $314.07
NM_203289 Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 2, mRNA. Full Length $505.47
ORF Sequence $166.17
Title Cisplatin hypersensitivity of testicular germ cell tumors is determined by high constitutive Noxa levels mediated by Oct-4 .
Author Gutekunst,M., Mueller,T., Weilbacher,A., Dengler,M.A., Bedke,J., Kruck,S., Oren,M., Aulitzky,W.E. and van der Kuip,H.
Journal Cancer Res. 73 (5), 1460-1469 (2013)
Title MBD6 is a direct target of Oct4 and controls the stemness and differentiation of adipose tissue-derived stem cells .
Author Jung,J.S., Jee,M.K., Cho,H.T., Choi,J.I., Im,Y.B., Kwon,O.H. and Kang,S.K.
Journal Cell. Mol. Life Sci. 70 (4), 711-728 (2013)
Title Identification of Oct4-activating compounds that enhance reprogramming efficiency .
Author Li,W., Tian,E., Chen,Z.X., Sun,G., Ye,P., Yang,S., Lu,D., Xie,J., Ho,T.V., Tsark,W.M., Wang,C., Horne,D.A., Riggs,A.D., Yip,M.L. and Shi,Y.
Journal Proc. Natl. Acad. Sci. U.S.A. 109 (51), 20853-20858 (2012)
Title EWS-Oct-4B, an alternative EWS-Oct-4 fusion gene, is a potent oncogene linked to human epithelial tumours .
Author Kim,S., Lim,B. and Kim,J.
Journal Br. J. Cancer 102 (2), 436-446 (2010)
Title Alternative translation of OCT4 by an internal ribosome entry site and its novel function in stress response .
Author Wang,X., Zhao,Y., Xiao,Z., Chen,B., Wei,Z., Wang,B., Zhang,J., Han,J., Gao,Y., Li,L., Zhao,H., Zhao,W., Lin,H. and Dai,J.
Journal Stem Cells 27 (6), 1265-1275 (2009)
Title The human OCT-4 isoforms differ in their ability to confer self-renewal .
Author Lee,J., Kim,H.K., Rho,J.Y., Han,Y.M. and Kim,J.
Journal J. Biol. Chem. 281 (44), 33554-33565 (2006)
Title EWSR1 is fused to POU5F1 in a bone tumor with translocation t(6;22)(p21;q12) .
Author Yamaguchi,S., Yamazaki,Y., Ishikawa,Y., Kawaguchi,N., Mukai,H. and Nakamura,T.
Journal Genes Chromosomes Cancer 43 (2), 217-222 (2005)
Title Localization of the OTF3 gene within the human MHC class I region by physical and meiotic mapping .
Author Crouau-Roy,B., Amadou,C., Bouissou,C., Clayton,J., Vernet,C., Ribouchon,M.T. and Pontarotti,P.
Journal Genomics 21 (1), 241-243 (1994)
Title Human Oct3 gene family: cDNA sequences, alternative splicing, gene organization, chromosomal location, and expression at low levels in adult tissues .
Author Takeda,J., Seino,S. and Bell,G.I.
Journal Nucleic Acids Res. 20 (17), 4613-4620 (1992)
Title Octamer-dependent regulation of the kFGF gene in embryonal carcinoma and embryonic stem cells .
Author Schoorlemmer,J. and Kruijer,W.
Journal Mech. Dev. 36 (1-2), 75-86 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878