• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU class 6 homeobox 1 (POU6F1), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu12619 Homo sapiens POU class 6 homeobox 1 (POU6F1), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu12619C Homo sapiens POU class 6 homeobox 1 (POU6F1), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002702.3, 223890224
Length 906 bp
Structure linear
Update Date 16-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens POU class 6 homeobox 1 (POU6F1), transcript variant 1, mRNA.
Product POU domain, class 6, transcription factor 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL832881.1, BC051326.1, DA026332.1, DA084199.1, AC139768.14, BM703234.1, CK002954.1 and AW445212.1. On Feb 20, 2009 this sequence version replaced gi:57163992.


Transcript Variant: This variant (1) represents the protein-coding transcript.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.


##Evidence-Data-START## Transcript exon combination :: AL832881.1, BC051326.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087, ERS025093 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_002693.3
CDS 483..1388
Misc Feature(1)114..116
Misc Feature(2)114..116
Misc Feature(3)897..1121
Misc Feature(4)897..1121
Misc Feature(5)1185..1361
Misc Feature(6)order(1185..1199,1203..1205,1254..1256,1272..1274,
Misc Feature(7)order(1191..1193,1200..1202,1320..1322,1329..1334,
Exon (1)1..398
Gene:POU6F1
Gene Synonym:BRN5; MPOU; TCFB1
Exon (2)399..527
Gene:POU6F1
Gene Synonym:BRN5; MPOU; TCFB1
Exon (3)528..731
Gene:POU6F1
Gene Synonym:BRN5; MPOU; TCFB1
Exon (4)732..873
Gene:POU6F1
Gene Synonym:BRN5; MPOU; TCFB1
Exon (5)874..1042
Gene:POU6F1
Gene Synonym:BRN5; MPOU; TCFB1
Exon (6)1043..4699
Gene:POU6F1
Gene Synonym:BRN5; MPOU; TCFB1
Translation MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLA SSPLPPPVAVRKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCS ETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAY SQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTS FTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQI P
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(179)-t, cdbSNP:375924107
complement(247)-g, adbSNP:372129770
complement(442)-dbSNP:
complement(442)-g, adbSNP:373820416
complement(471)-t, cdbSNP:151163072
complement(474)-t, adbSNP:370576673
complement(503)-c, adbSNP:190687928
complement(516)-t, cdbSNP:77905600
complement(564)-dbSNP:
complement(564)-t, adbSNP:370748294
complement(569)-c, adbSNP:181238666
complement(633)-t, cdbSNP:147582637
complement(693)-t, g, adbSNP:201399148
complement(798)-dbSNP:
complement(798)-t, cdbSNP:373376949
complement(800)-g, adbSNP:145166430
complement(801)-t, cdbSNP:139629485
complement(815)-g, adbSNP:147830095
complement(848)-g, adbSNP:7136904
complement(854)-g, adbSNP:376717396
complement(885)-dbSNP:
complement(885)-g, adbSNP:371835039
complement(895)-t, cdbSNP:139626786
complement(950)-t, gdbSNP:150600315
complement(962)-t, cdbSNP:367663714
complement(1022..1023)-, gdbSNP:147563855
complement(1090)-dbSNP:
complement(1090)-g, adbSNP:375633440
complement(1091)-t, cdbSNP:141839526
complement(1112)-g, adbSNP:139547928
complement(1122)-g, cdbSNP:190452607
complement(1153)-t, adbSNP:372234587
complement(1212)-g, cdbSNP:369846174
complement(1222)-t, cdbSNP:200557831
complement(1231)-t, cdbSNP:186003252
1271+a, gdbSNP:2228250
complement(1338)-g, adbSNP:199706351
complement(1370)-g, adbSNP:180748178
complement(1409)-g, cdbSNP:137997442
complement(1421)-g, adbSNP:371004191
complement(1436)-t, cdbSNP:201594593
complement(1535)-t, cdbSNP:115051055
1539+c, tdbSNP:1126902
complement(1623)-t, cdbSNP:146938447
complement(1642)-t, cdbSNP:141150055
complement(1680)-t, gdbSNP:386447434
complement(1680)-c, adbSNP:12321105
complement(1875)-t, cdbSNP:373440989
complement(1904)-t, cdbSNP:188621755
1912+c, tdbSNP:3490
complement(1912)-g, adbSNP:386583063
1917+a, gdbSNP:1126904
complement(1977)-g, adbSNP:1126905
complement(1983)-t, cdbSNP:371391428
2002+a, gdbSNP:145443725
complement(2049)-g, cdbSNP:73305801
complement(2055)-g, adbSNP:149748726
complement(2179)-t, cdbSNP:183891028
complement(2200..2201)-, adbSNP:34561796
complement(2235)-c, adbSNP:140859029
complement(2537)-g, adbSNP:150996598
2566+g, tdbSNP:144087815
complement(2645)-g, adbSNP:376736452
complement(2652)-t, cdbSNP:140091371
complement(2821)-t, cdbSNP:146097557
complement(2906)-t, cdbSNP:192230011
2994+c, gdbSNP:144254019
complement(3006)-t, cdbSNP:148510381
complement(3036)-t, cdbSNP:59898968
complement(3107)-t, cdbSNP:144653185
complement(3118)-t, cdbSNP:77962777
complement(3128)-t, cdbSNP:149443201
complement(3132)-t, cdbSNP:113804849
complement(3145..3146)-, tgdbSNP:142673259
complement(3152)-t, cdbSNP:115367412
complement(3155)-g, cdbSNP:188895029
complement(3191)-t, cdbSNP:368226429
complement(3229)-g, adbSNP:116607284
complement(3230)-t, cdbSNP:10747605
complement(3288)-g, adbSNP:371610272
complement(3332)-c, adbSNP:117061312
complement(3370)-g, adbSNP:111665877
complement(3418)-t, gdbSNP:138938883
complement(3427)-g, adbSNP:185869567
complement(3441)-t, cdbSNP:150676262
complement(3455)-g, adbSNP:193099734
complement(3517..3518)-, ggdbSNP:200488247
complement(3528)-, tdbSNP:35515176
complement(3560)-g, adbSNP:143971014
complement(3677..3678)-, cgdbSNP:367854102
complement(3678)-c, adbSNP:10876151
complement(3705)-t, cdbSNP:76213841
complement(3837..3838)-, cdbSNP:375451951
complement(3853)-t, cdbSNP:11169754
complement(3872)-t, cdbSNP:146961609
complement(4022)-t, cdbSNP:188891651
complement(4029)-c, adbSNP:78392974
complement(4049)-t, cdbSNP:376294231
complement(4162)-g, adbSNP:112726096
complement(4173)-t, cdbSNP:11169753
complement(4217)-t, cdbSNP:116037696
complement(4234)-t, cdbSNP:115353814
complement(4320)-g, adbSNP:79809537
complement(4404)-t, cdbSNP:376937595
complement(4411)-g, adbSNP:11738
complement(4470)-t, cdbSNP:1607
complement(4471)-g, adbSNP:76928355
complement(4609)-g, adbSNP:147827177
complement(4686)-t, adbSNP:141188998
Gene SymbolPOU6F1
Gene SynonymBRN5; MPOU; TCFB1
Chromosome12
Locus Map12q13.13
Title Transcription factor POU6F1 is important for proliferation of clear cell adenocarcinoma of the ovary and is a potential new molecular target .
Author Suzuki N, Yoshioka N, Uekawa A, Matsumura N, Tozawa A, Koike J, Konishi I, Kiguchi K and Ishizuka B.
Journal Int. J. Gynecol. Cancer 20 (2), 212-219 (2010)
Title POU6F1 is the transcription factor that might be involved in cell proliferation of clear cell adenocarcinoma of the ovary .
Author Yoshioka N, Suzuki N, Uekawa A, Kiguchi K and Ishizuka B.
Journal Hum. Cell 22 (4), 94-100 (2009)
Title Structure of human Brn-5 transcription factor in complex with CRH gene promoter .
Author Pereira JH and Kim SH.
Journal J. Struct. Biol. 167 (2), 159-165 (2009)
Title Crystallization and preliminary X-ray analysis of human Brn-5 transcription factor in complex with DNA .
Author Pereira JH, Ha SC and Kim SH.
Journal Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 64 (PT 3), 175-178 (2008)
Title Expression of transcription regulating genes in human preimplantation embryos .
Author Abdel-Rahman B, Fiddler M, Rappolee D and Pergament E.
Journal Hum. Reprod. 10 (10), 2787-2792 (1995)
Title A human POU domain gene, mPOU, is expressed in developing brain and specific adult tissues .
Author Wey E, Lyons GE and Schafer BW.
Journal Eur. J. Biochem. 220 (3), 753-762 (1994)
Title A novel POU domain protein which binds to the T-cell receptor beta enhancer .
Author Messier H, Brickner H, Gaikwad J and Fotedar A.
Journal Mol. Cell. Biol. 13 (9), 5450-5460 (1993)
Title Human Oct3 gene family: cDNA sequences, alternative splicing, gene organization, chromosomal location, and expression at low levels in adult tissues .
Author Takeda J, Seino S and Bell GI.
Journal Nucleic Acids Res. 20 (17), 4613-4620 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.