Homo sapiens POU class 6 homeobox 1 (POU6F1), transcript variant 1, mRNA.
| RefSeq Version | NM_002702.3, 223890224 |
| Length | 4715 bp |
| Structure | linear |
| Update Date | 13-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens POU class 6 homeobox 1 (POU6F1), transcript variant 1, mRNA. |
| Product | POU domain, class 6, transcription factor 1 |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL832881.1, BC051326.1, DA026332.1, DA084199.1, AC139768.14, BM703234.1, CK002954.1 and AW445212.1. On Feb 20, 2009 this sequence version replaced gi:57163992. Transcript Variant: This variant (1) represents the protein-coding transcript. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. COMPLETENESS: complete on the 3' end. |
| RefSeq | NP_002693.3 |
| CDS | 483..1388 | Exon (1) | 1..398 | Exon (2) | 1..398 | Exon (3) | 399..527 | Exon (4) | 528..731 | Exon (5) | 732..873 | Exon (6) | 874..1042 | Exon (7) | 1043..4699 |
| Translation | MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLA
SSPLPPPVAVRKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCS
ETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAY
SQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTS
FTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQI
P
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(516) | - | t, c | dbSNP:77905600 |
| complement(848) | - | g, a | dbSNP:7136904 |
| 1271 | + | a, g | dbSNP:2228250 |
| complement(1535) | - | t, c | dbSNP:115051055 |
| 1539 | + | c, t | dbSNP:1126902 |
| complement(1680) | - | c, a | dbSNP:12321105 |
| complement(1830) | - | c, a | dbSNP:75745016 |
| complement(1904) | - | t, c | dbSNP:115365959 |
| 1912 | + | c, t | dbSNP:3490 |
| 1917 | + | a, g | dbSNP:1126904 |
| 1977 | + | a, g | dbSNP:1126905 |
| complement(2049) | - | g, c | dbSNP:73305801 |
| complement(2200..2201) | - | , a | dbSNP:34561796 |
| complement(3036) | - | t, c | dbSNP:59898968 |
| complement(3118) | - | t, c | dbSNP:77962777 |
| complement(3132) | - | t, c | dbSNP:113804849 |
| complement(3152) | - | t, c | dbSNP:115367412 |
| complement(3229) | - | g, a | dbSNP:116607284 |
| complement(3230) | - | t, c | dbSNP:10747605 |
| complement(3332) | - | c, a | dbSNP:117061312 |
| complement(3370) | - | g, a | dbSNP:111665877 |
| complement(3517) | - | , gg | dbSNP:75481667 |
| complement(3528) | - | , t | dbSNP:35515176 |
| complement(3678) | - | c, a | dbSNP:10876151 |
| complement(3705) | - | t, c | dbSNP:76213841 |
| complement(3853) | - | t, c | dbSNP:11169754 |
| complement(4029) | - | c, a | dbSNP:78392974 |
| complement(4162) | - | g, a | dbSNP:112726096 |
| complement(4173) | - | t, c | dbSNP:11169753 |
| complement(4217) | - | t, c | dbSNP:116037696 |
| complement(4234) | - | t, c | dbSNP:115353814 |
| complement(4320) | - | g, a | dbSNP:79809537 |
| complement(4411) | - | g, a | dbSNP:11738 |
| complement(4470) | - | t, c | dbSNP:1607 |
| complement(4471) | - | g, a | dbSNP:76928355 |
| Gene Symbol | POU6F1 |
| Gene Synonym | BRN5; MPOU; TCFB1 |
| Chromosome | 12 |
| Locus Map | 12q13.13 |
| All Transcripts | NM_002702 |
| Title | Transcription factor POU6F1 is important for proliferation of clear cell adenocarcinoma of the ovary and is a potential new molecular target . |
| Author | Suzuki,N., Yoshioka,N., Uekawa,A., Matsumura,N., Tozawa,A., Koike,J., Konishi,I., Kiguchi,K. and Ishizuka,B. |
| Journal | Int. J. Gynecol. Cancer 20 (2), 212-219 (2010) |
| Title | POU6F1 is the transcription factor that might be involved in cell proliferation of clear cell adenocarcinoma of the ovary . |
| Author | Yoshioka,N., Suzuki,N., Uekawa,A., Kiguchi,K. and Ishizuka,B. |
| Journal | Hum. Cell 22 (4), 94-100 (2009) |
| Title | Structure of human Brn-5 transcription factor in complex with CRH gene promoter . |
| Author | Pereira,J.H. and Kim,S.H. |
| Journal | J. Struct. Biol. 167 (2), 159-165 (2009) |
| Title | Crystallization and preliminary X-ray analysis of human Brn-5 transcription factor in complex with DNA . |
| Author | Pereira,J.H., Ha,S.C. and Kim,S.H. |
| Journal | Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 64 (PT 3), 175-178 (2008) |
| Title | Expression of transcription regulating genes in human preimplantation embryos . |
| Author | Abdel-Rahman,B., Fiddler,M., Rappolee,D. and Pergament,E. |
| Journal | Hum. Reprod. 10 (10), 2787-2792 (1995) |
| Title | A human POU domain gene, mPOU, is expressed in developing brain and specific adult tissues . |
| Author | Wey,E., Lyons,G.E. and Schafer,B.W. |
| Journal | Eur. J. Biochem. 220 (3), 753-762 (1994) |
| Title | A novel POU domain protein which binds to the T-cell receptor beta enhancer . |
| Author | Messier,H., Brickner,H., Gaikwad,J. and Fotedar,A. |
| Journal | Mol. Cell. Biol. 13 (9), 5450-5460 (1993) |
| Title | Human Oct3 gene family: cDNA sequences, alternative splicing, gene organization, chromosomal location, and expression at low levels in adult tissues . |
| Author | Takeda,J., Seino,S. and Bell,G.I. |
| Journal | Nucleic Acids Res. 20 (17), 4613-4620 (1992) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |