• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens phosphoribosyl pyrophosphate amidotransferase (PPAT), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu03961 Homo sapiens phosphoribosyl pyrophosphate amidotransferase (PPAT), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu03961C Homo sapiens phosphoribosyl pyrophosphate amidotransferase (PPAT), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_002703.4, 325296911
Length 1554 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens phosphoribosyl pyrophosphate amidotransferase (PPAT), mRNA.
Product amidophosphoribosyltransferase proprotein
Comment

Summary: The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. It is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosythetic pathway. This gene and PAICS/AIRC gene, a bifunctional enzyme catalyzing steps six and seven of this pathway, are located in close proximity on chromosome 4, and divergently transcribed from an intergenic region. [provided by RefSeq, Mar 2011].


##Evidence-Data-START## Transcript exon combination :: U00238.1, D13757.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_002694.3
CDS 160..1713
Misc Feature(1)160..162
Misc Feature(2)160..162
Misc Feature(3)181..1704
Misc Feature(4)193..1044
Misc Feature(5)order(193..195,286..291,436..438,523..528,598..600)
Misc Feature(6)order(259..264,271..273,292..294,487..489,604..606,
Misc Feature(7)1075..1485
Misc Feature(8)order(1132..1134,1138..1140,1324..1332,1336..1350,
Exon (1)1..287
Gene:PPAT
Gene Synonym:ATASE; GPAT; PRAT
Exon (2)288..354
Gene:PPAT
Gene Synonym:ATASE; GPAT; PRAT
Exon (3)355..561
Gene:PPAT
Gene Synonym:ATASE; GPAT; PRAT
Exon (4)562..674
Gene:PPAT
Gene Synonym:ATASE; GPAT; PRAT
Exon (5)675..820
Gene:PPAT
Gene Synonym:ATASE; GPAT; PRAT
Exon (6)821..893
Gene:PPAT
Gene Synonym:ATASE; GPAT; PRAT
Exon (7)894..1045
Gene:PPAT
Gene Synonym:ATASE; GPAT; PRAT
Exon (8)1046..1173
Gene:PPAT
Gene Synonym:ATASE; GPAT; PRAT
Exon (9)1174..1395
Gene:PPAT
Gene Synonym:ATASE; GPAT; PRAT
Exon (10)1396..1516
Gene:PPAT
Gene Synonym:ATASE; GPAT; PRAT
Exon (11)1517..3703
Gene:PPAT
Gene Synonym:ATASE; GPAT; PRAT
Translation MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPT FKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVA HNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEA PTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFL SIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVY TVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQP NMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP PIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKE KKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(35)-dbSNP:
complement(35)-t, cdbSNP:60112184
complement(53)-g, adbSNP:3822001
complement(67)-g, cdbSNP:59010837
complement(70)-g, adbSNP:60097571
complement(88)-t, gdbSNP:189152163
complement(89)-t, cdbSNP:375418740
complement(109)-g, cdbSNP:201978310
complement(118)-c, adbSNP:58548914
complement(122)-g, adbSNP:6843073
complement(134)-c, adbSNP:202181751
complement(155)-c, adbSNP:375080631
complement(213)-t, gdbSNP:370765017
complement(216)-g, adbSNP:142572514
complement(320)-dbSNP:
complement(320)-t, cdbSNP:144550932
complement(323)-g, cdbSNP:142893232
complement(329)-g, adbSNP:200714501
330+c, gdbSNP:11538098
complement(334)-t, gdbSNP:147241535
complement(347)-g, adbSNP:143863963
complement(405)-dbSNP:
complement(405)-t, cdbSNP:200923724
complement(408)-g, adbSNP:138162667
complement(449)-t, gdbSNP:150840139
complement(484)-t, cdbSNP:141469911
complement(615)-dbSNP:
complement(615)-g, adbSNP:368701517
complement(701)-dbSNP:
complement(701)-g, cdbSNP:148624264
complement(729)-g, adbSNP:372357103
complement(787)-g, adbSNP:368322366
complement(788)-t, cdbSNP:374359651
complement(810)-t, gdbSNP:148350001
840+dbSNP:
840+a, g, tdbSNP:2271924
complement(989)-dbSNP:
complement(989)-g, adbSNP:113135347
complement(1038)-t, cdbSNP:201692437
complement(1094)-dbSNP:
complement(1094)-g, adbSNP:115979484
complement(1113)-t, cdbSNP:138492190
complement(1128)-g, adbSNP:145906060
complement(1146)-t, cdbSNP:149024503
complement(1164)-g, adbSNP:77101789
complement(1177)-dbSNP:
complement(1177)-t, cdbSNP:369370347
complement(1185)-t, cdbSNP:35420817
complement(1242)-g, adbSNP:112406471
complement(1302)-t, cdbSNP:114731967
complement(1320)-g, adbSNP:375281372
complement(1389)-t, gdbSNP:372969235
complement(1566)-dbSNP:
complement(1566)-t, cdbSNP:2412738
complement(1575)-c, adbSNP:76674380
complement(1579)-t, gdbSNP:3908150
complement(1585)-t, cdbSNP:147822472
complement(1621)-g, adbSNP:2660744
complement(1626)-t, gdbSNP:375085596
complement(1663)-t, gdbSNP:144451574
complement(1704)-t, cdbSNP:371980582
complement(1707)-t, adbSNP:200268394
complement(1782)-t, cdbSNP:113509123
complement(1823)-g, adbSNP:186916603
complement(1830..1831)-, ggtaaadbSNP:3036860
complement(1834..1835)-, taaaggdbSNP:199711867
complement(1857..1858)-, adbSNP:34605681
complement(1861)-c, adbSNP:199983276
complement(1875)-t, gdbSNP:184074077
complement(1997)-g, cdbSNP:3733326
complement(2015)-t, cdbSNP:138098736
2166+g, tdbSNP:147000512
2200+a, tdbSNP:1042037
complement(2200)-, adbSNP:200162900
complement(2203..2206)-, attadbSNP:376877956
complement(2203)-t, adbSNP:75801826
complement(2203)-, adbSNP:34737334
complement(2206..2207)-, tadbSNP:371730196
complement(2206)-t, adbSNP:78397688
complement(2206)-, adbSNP:35057235
complement(2207..2209)-, attdbSNP:201291539
complement(2208..2209)-, tdbSNP:200547738
complement(2250..2251)-, ataatdbSNP:199954490
complement(2259..2262)-, attadbSNP:77344473
complement(2259)-c, adbSNP:191026688
complement(2262..2264)-, ttadbSNP:200020195
complement(2270)-g, adbSNP:10000147
complement(2369)-g, adbSNP:143039832
complement(2430)-t, cdbSNP:111673999
complement(2609..2610)-, gdbSNP:34557332
complement(2884)-c, adbSNP:185325670
complement(2911)-g, adbSNP:180706331
2933+c, gdbSNP:1042040
2965+a, tdbSNP:1062466
complement(2975)-t, adbSNP:146657767
complement(3064)-t, gdbSNP:188743398
complement(3076)-g, adbSNP:186476270
complement(3089)-g, cdbSNP:140985493
complement(3155)-t, cdbSNP:181233999
complement(3231)-g, adbSNP:115400038
complement(3232)-t, cdbSNP:17086746
complement(3259)-g, adbSNP:376970568
complement(3323)-t, gdbSNP:372821097
complement(3375)-t, cdbSNP:3796548
complement(3375)-t, cdbSNP:41530949
complement(3516..3517)-, adbSNP:397739301
complement(3524..3525)-, adbSNP:3839138
Gene SymbolPPAT
Gene SynonymATASE; GPAT; PRAT
Chromosome4
Locus Map4q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002703 Homo sapiens phosphoribosyl pyrophosphate amidotransferase (PPAT), mRNA. On-demand $219.00 7-9
Title Interdomain signaling in glutamine phosphoribosylpyrophosphate amidotransferase .
Author Bera AK, Chen S, Smith JL and Zalkin H.
Journal J. Biol. Chem. 274 (51), 36498-36504 (1999)
Title Growth factor-regulated expression of enzymes involved in nucleotide biosynthesis: a novel mechanism of growth factor action .
Author Gassmann MG, Stanzel A and Werner S.
Journal Oncogene 18 (48), 6667-6676 (1999)
Title Role of NRF-1 in bidirectional transcription of the human GPAT-AIRC purine biosynthesis locus .
Author Chen S, Nagy PL and Zalkin H.
Journal Nucleic Acids Res. 25 (9), 1809-1816 (1997)
Title Two genes for de novo purine nucleotide synthesis on human chromosome 4 are closely linked and divergently transcribed .
Author Brayton KA, Chen Z, Zhou G, Nagy PL, Gavalas A, Trent JM, Deaven LL, Dixon JE and Zalkin H.
Journal J. Biol. Chem. 269 (7), 5313-5321 (1994)
Title Molecular cloning of human amidophosphoribosyltransferase .
Author Iwahana H, Oka J, Mizusawa N, Kudo E, Ii S, Yoshimoto K, Holmes EW and Itakura M.
Journal Biochem. Biophys. Res. Commun. 190 (1), 192-200 (1993)
Title De novo purine nucleotide biosynthesis .
Author Zalkin H and Dixon JE.
Journal Prog. Nucleic Acid Res. Mol. Biol. 42, 259-287 (1992)
Title Assignment of the gene for phosphoribosylpyrophosphate amidotransferase to the pter leads to q21 region of human chromosome 4 .
Author Stanley,W. and Chu,E.H.
Journal Cytogenet. Cell Genet. 22 (1-6), 228-231 (1978)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.