• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002730 Homo sapiens protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_002730.3, 46909581
Length 2689 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 1, mRNA.
Product cAMP-dependent protein kinase catalytic subunit alpha isoform 1
Comment

Summary: cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is a member of the Ser/Thr protein kinase family and is a catalytic subunit of cAMP-dependent protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longer isoform (1).

RefSeq NP_002721.1
CDS 201..1256
Misc Feature(1)231..233
Misc Feature(2)231..233
Misc Feature(3)246..1253
Misc Feature(4)324..1193
Misc Feature(5)345..347
Misc Feature(6)order(348..368,372..374,411..413,417..419,513..515,
Misc Feature(7)order(351..368,372..374,411..413,417..419,447..449,
Misc Feature(8)order(354..356,360..365,447..455,582..584,588..590,
Misc Feature(9)order(354..356,360..362,450..455,459..464,582..584,
Misc Feature(10)618..620
Misc Feature(11)750..812
Misc Feature(12)786..788
Misc Feature(13)786..788
Misc Feature(14)792..794
Misc Feature(15)792..794
Misc Feature(16)804..806
Misc Feature(17)804..806
Misc Feature(18)1215..1217
Misc Feature(19)1215..1217
Exon (1)1..246
Gene:PRKACA
Gene Synonym:PKACA
Exon (2)247..308
Gene:PRKACA
Gene Synonym:PKACA
Exon (3)309..437
Gene:PRKACA
Gene Synonym:PKACA
Exon (4)438..536
Gene:PRKACA
Gene Synonym:PKACA
Exon (5)537..619
Gene:PRKACA
Gene Synonym:PKACA
Exon (6)620..746
Gene:PRKACA
Gene Synonym:PKACA
Exon (7)747..842
Gene:PRKACA
Gene Synonym:PKACA
Exon (8)843..965
Gene:PRKACA
Gene Synonym:PKACA
Exon (9)966..1130
Gene:PRKACA
Gene Synonym:PKACA
Exon (10)1131..2680
Gene:PRKACA
Gene Synonym:PKACA
Translation MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(20)-dbSNP:
complement(20)-g, adbSNP:143276259
complement(302)-dbSNP:
complement(302)-g, adbSNP:56105247
complement(303)-t, cdbSNP:142045517
complement(321)-dbSNP:
complement(321)-c, adbSNP:56029020
complement(337)-t, cdbSNP:56085217
complement(349)-t, g, adbSNP:112360106
complement(396)-t, cdbSNP:201769960
complement(408)-g, adbSNP:201225070
complement(506)-dbSNP:
complement(506)-t, cdbSNP:202032822
complement(521)-g, cdbSNP:148811989
complement(569)-dbSNP:
complement(569)-g, adbSNP:201100703
complement(581)-t, cdbSNP:78098302
complement(608)-g, adbSNP:141320866
complement(609)-t, cdbSNP:148280386
complement(653)-dbSNP:
complement(653)-g, adbSNP:145751355
complement(732)-t, gdbSNP:201595411
complement(741)-t, cdbSNP:142007512
complement(760)-dbSNP:
complement(760)-t, gdbSNP:11541563
complement(873)-dbSNP:
complement(873)-, gdbSNP:34988264
complement(911)-t, cdbSNP:137911238
complement(991)-dbSNP:
complement(991)-g, cdbSNP:35635531
complement(1042)-t, cdbSNP:146946205
complement(1043)-g, cdbSNP:3729858
complement(1121)-g, adbSNP:200573717
complement(1124)-t, cdbSNP:149272491
complement(1126)-t, cdbSNP:187770246
complement(1142)-dbSNP:
complement(1142)-g, adbSNP:145797642
complement(1155)-g, adbSNP:149832080
complement(1245)-g, adbSNP:141087932
complement(1264)-t, gdbSNP:186700926
complement(1267)-g, cdbSNP:41296312
complement(1276)-t, adbSNP:41296314
complement(1298..1304)-, aaaaaagdbSNP:141786059
complement(1344)-g, adbSNP:41296316
complement(1394)-, cdbSNP:35571116
complement(1498)-g, adbSNP:11541565
complement(1599)-c, adbSNP:41296320
complement(1638)-t, gdbSNP:11541564
complement(1705)-g, adbSNP:41296322
complement(1755)-t, cdbSNP:192062046
complement(1789)-t, adbSNP:41296324
complement(2040)-c, adbSNP:181393862
complement(2178)-g, adbSNP:189384496
complement(2207)-g, adbSNP:138923029
complement(2418)-t, gdbSNP:184594472
complement(2445..2446)-, tdbSNP:41296326
complement(2487)-g, adbSNP:41296328
complement(2493)-c, adbSNP:15247
complement(2566)-t, cdbSNP:181006322
complement(2624)-c, adbSNP:189139001
Gene SymbolPRKACA
Gene SynonymPKACA
Chromosome19
Locus Map19p13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002730 Homo sapiens protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 1, mRNA. In-stock $418.00 $369.00 10
NM_207518 Homo sapiens protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 2, mRNA. On-demand $549.00 14
Title Antagonism of VEGF-A-induced increase in vascular permeability by an integrin alpha3beta1-Shp-1-cAMP/PKA pathway .
Author Kim,S.H., Cho,Y.R., Kim,H.J., Oh,J.S., Ahn,E.K., Ko,H.J., Hwang,B.J., Lee,S.J., Cho,Y., Kim,Y.K., Stetler-Stevenson,W.G. and Seo,D.W.
Journal Blood 120 (24), 4892-4902 (2012)
Title Glucagon-like peptide-1 inhibits angiotensin II-induced mesangial cell damage via protein kinase A .
Author Ishibashi,Y., Matsui,T., Ojima,A., Nishino,Y., Nakashima,S., Maeda,S. and Yamagishi,S.
Journal Microvasc. Res. 84 (3), 395-398 (2012)
Title Prostaglandin E2 stimulates S100A8 expression by activating protein kinase A and CCAAT/enhancer-binding-protein-beta in prostate cancer cells .
Author Miao,L., Grebhardt,S., Shi,J., Peipe,I., Zhang,J. and Mayer,D.
Journal Int. J. Biochem. Cell Biol. 44 (11), 1919-1928 (2012)
Title PKA and PDE4D3 anchoring to AKAP9 provides distinct regulation of cAMP signals at the centrosome .
Author Terrin,A., Monterisi,S., Stangherlin,A., Zoccarato,A., Koschinski,A., Surdo,N.C., Mongillo,M., Sawa,A., Jordanides,N.E., Mountford,J.C. and Zaccolo,M.
Journal J. Cell Biol. 198 (4), 607-621 (2012)
Title Phytoestrogen genistein up-regulates endothelial nitric oxide synthase expression via activation of cAMP response element-binding protein in human aortic endothelial cells .
Author Si,H., Yu,J., Jiang,H., Lum,H. and Liu,D.
Journal Endocrinology 153 (7), 3190-3198 (2012)
Title The dual role of the cAMP-dependent protein kinase C alpha subunit in T-cell receptor-triggered T-lymphocytes effector functions .
Author Sugiyama,H., Chen,P., Hunter,M., Taffs,R. and Sitkovsky,M.
Journal J. Biol. Chem. 267 (35), 25256-25263 (1992)
Title The two forms of bovine heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase result from alternative splicing .
Author Rider,M.H., Vandamme,J., Lebeau,E., Vertommen,D., Vidal,H., Rousseau,G.G., Vandekerckhove,J. and Hue,L.
Journal Biochem. J. 285 (PT 2), 405-411 (1992)
Title Mechanism of interferon action. cDNA structure and regulation of a novel splice-site variant of the catalytic subunit of human protein kinase A from interferon-treated human cells .
Author Thomis,D.C., Floyd-Smith,G. and Samuel,C.E.
Journal J. Biol. Chem. 267 (15), 10723-10728 (1992)
Title Sequence of two phosphorylated sites in the catalytic subunit of bovine cardiac muscle adenosine 3':5'-monophosphate-dependent protein kinase .
Author Shoji,S., Titani,K., Demaille,J.G. and Fischer,E.H.
Journal J. Biol. Chem. 254 (14), 6211-6214 (1979)
Title Direct phosphorylation of brain tyrosine hydroxylase by cyclic AMP-dependent protein kinase: mechanism of enzyme activation .
Author Joh,T.H., Park,D.H. and Reis,D.J.
Journal Proc. Natl. Acad. Sci. U.S.A. 75 (10), 4744-4748 (1978)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.