• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu51697 Homo sapiens protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu51697C Homo sapiens protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_002730.3, 46909581
Length 1056 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 1, mRNA.
Product cAMP-dependent protein kinase catalytic subunit alpha isoform 1
Comment

Summary: cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is a member of the Ser/Thr protein kinase family and is a catalytic subunit of cAMP-dependent protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longer isoform (1).

RefSeq NP_002721.1
CDS 201..1256
Misc Feature(1)231..233
Misc Feature(2)231..233
Misc Feature(3)324..1193
Misc Feature(4)330..1094
Misc Feature(5)345..347
Misc Feature(6)order(348..368,372..374,411..413,417..419,513..515,
Misc Feature(7)order(351..368,372..374,411..413,417..419,447..449,
Misc Feature(8)order(354..356,360..365,447..455,582..584,588..590,
Misc Feature(9)order(354..356,360..362,450..455,459..464,582..584,
Misc Feature(10)618..620
Misc Feature(11)750..812
Misc Feature(12)786..788
Misc Feature(13)786..788
Misc Feature(14)792..794
Misc Feature(15)792..794
Misc Feature(16)804..806
Misc Feature(17)804..806
Misc Feature(18)1215..1217
Misc Feature(19)1215..1217
Exon (1)1..246
Gene:PRKACA
Gene Synonym:PKACA
Exon (2)247..308
Gene:PRKACA
Gene Synonym:PKACA
Exon (3)309..437
Gene:PRKACA
Gene Synonym:PKACA
Exon (4)438..536
Gene:PRKACA
Gene Synonym:PKACA
Exon (5)537..619
Gene:PRKACA
Gene Synonym:PKACA
Exon (6)620..746
Gene:PRKACA
Gene Synonym:PKACA
Exon (7)747..842
Gene:PRKACA
Gene Synonym:PKACA
Exon (8)843..965
Gene:PRKACA
Gene Synonym:PKACA
Exon (9)966..1130
Gene:PRKACA
Gene Synonym:PKACA
Exon (10)1131..2680
Gene:PRKACA
Gene Synonym:PKACA
Translation MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(20)-dbSNP:
complement(20)-g, adbSNP:143276259
complement(302)-dbSNP:
complement(302)-g, adbSNP:56105247
complement(303)-t, cdbSNP:142045517
complement(321)-dbSNP:
complement(321)-c, adbSNP:56029020
complement(337)-t, cdbSNP:56085217
complement(349)-t, g, adbSNP:112360106
complement(349)-t, cdbSNP:386420932
complement(368)-c, adbSNP:373468300
complement(396)-t, cdbSNP:201769960
complement(408)-g, adbSNP:201225070
complement(426)-t, cdbSNP:369286962
complement(458)-dbSNP:
complement(458)-g, adbSNP:368239098
complement(462)-g, adbSNP:376284068
complement(491)-t, cdbSNP:371232485
complement(506)-t, cdbSNP:202032822
complement(518)-t, cdbSNP:376182047
complement(521)-g, cdbSNP:148811989
complement(541)-dbSNP:
complement(541)-t, cdbSNP:369058901
complement(554)-g, adbSNP:376915447
complement(569)-g, adbSNP:201100703
complement(581)-t, cdbSNP:78098302
complement(608)-g, adbSNP:141320866
complement(609)-t, cdbSNP:148280386
complement(653)-dbSNP:
complement(653)-g, adbSNP:145751355
complement(732)-t, gdbSNP:201595411
complement(741)-t, cdbSNP:142007512
760+dbSNP:
760+g, tdbSNP:11541563
complement(774)-t, cdbSNP:372210586
complement(873)-dbSNP:
complement(873)-, gdbSNP:34988264
complement(911)-t, cdbSNP:137911238
complement(991)-dbSNP:
complement(991)-g, cdbSNP:35635531
1043+c, gdbSNP:3729858
complement(1121)-g, adbSNP:200573717
complement(1124)-t, cdbSNP:149272491
complement(1126)-t, cdbSNP:187770246
complement(1127)-t, cdbSNP:371711255
complement(1142)-dbSNP:
complement(1142)-g, adbSNP:145797642
complement(1155)-g, adbSNP:149832080
complement(1161)-g, cdbSNP:373941966
complement(1175)-t, cdbSNP:370893378
complement(1196)-t, cdbSNP:370912699
complement(1210)-t, cdbSNP:377316394
complement(1245)-g, adbSNP:141087932
complement(1264)-t, gdbSNP:186700926
1267+c, gdbSNP:41296312
1276+a, tdbSNP:41296314
complement(1277)-t, cdbSNP:368971640
complement(1298..1304)-, aaaaaagdbSNP:141786059
1344+a, gdbSNP:41296316
complement(1394)-, cdbSNP:35571116
complement(1498)-g, adbSNP:11541565
1599+a, cdbSNP:41296320
complement(1638)-t, gdbSNP:11541564
complement(1638)-c, adbSNP:386518816
1705+a, gdbSNP:41296322
complement(1755)-t, cdbSNP:192062046
1789+a, tdbSNP:41296324
complement(1841)-g, adbSNP:374398241
complement(1879)-g, adbSNP:372738854
complement(1931)-g, adbSNP:371294220
complement(2040)-c, adbSNP:181393862
complement(2178)-g, adbSNP:189384496
2207+a, gdbSNP:138923029
complement(2337)-g, cdbSNP:373483298
complement(2418)-t, gdbSNP:184594472
complement(2444..2445)-, tdbSNP:41296326
complement(2487)-g, adbSNP:41296328
2493+a, cdbSNP:15247
complement(2542)-g, cdbSNP:369471735
complement(2566)-t, cdbSNP:181006322
complement(2624)-c, adbSNP:189139001
Gene SymbolPRKACA
Gene SynonymPKACA
Chromosome19
Locus Map19p13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_207518 Homo sapiens protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_002730 Homo sapiens protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 1, mRNA. In-stock $99.00 5-7
XM_005259984 PREDICTED: Homo sapiens protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant X1, mRNA. On-demand $219.00 7-9
Title Regulation of the biogenesis of OXPHOS complexes in cell transition from replicating to quiescent state: involvement of PKA and effect of hydroxytyrosol .
Author Signorile A, Micelli L, De Rasmo D, Santeramo A, Papa F, Ficarella R, Gattoni G, Scacco S and Papa S.
Journal Biochim. Biophys. Acta 1843 (4), 675-684 (2014)
Title Constitutive activation of PKA catalytic subunit in adrenal Cushing's syndrome .
Author Beuschlein F, Fassnacht M, Assie G, Calebiro D, Stratakis CA, Osswald A, Ronchi CL, Wieland T, Sbiera S, Faucz FR, Schaak K, Schmittfull A, Schwarzmayr T, Barreau O, Vezzosi D, Rizk-Rabin M, Zabel U, Szarek E, Salpea P, Forlino A, Vetro A, Zuffardi O, Kisker C, Diener S, Meitinger T, Lohse MJ, Reincke M, Bertherat J, Strom
Journal N. Engl. J. Med. 370 (11), 1019-1028 (2014)
Title Detection of a recurrent DNAJB1-PRKACA chimeric transcript in fibrolamellar hepatocellular carcinoma .
Author Honeyman JN, Simon EP, Robine N, Chiaroni-Clarke R, Darcy DG, Lim II, Gleason CE, Murphy JM, Rosenberg BR, Teegan L, Takacs CN, Botero S, Belote R, Germer S, Emde AK, Vacic V, Bhanot U, LaQuaglia
Journal Science 343 (6174), 1010-1014 (2014)
Title Human heart failure is accompanied by altered protein kinase A subunit expression and post-translational state .
Author Han YS, Arroyo J and Ogut O.
Journal Arch. Biochem. Biophys. 538 (1), 25-33 (2013)
Title Protein kinase A and phosphodiesterase-4D3 binding to coding polymorphisms of cardiac muscle anchoring protein (mAKAP) .
Author Rababa'h A, Craft JW Jr, Wijaya CS, Atrooz F, Fan Q, Singh S, Guillory AN, Katsonis P, Lichtarge O and McConnell BK.
Journal J. Mol. Biol. 425 (18), 3277-3288 (2013)
Title The dual role of the cAMP-dependent protein kinase C alpha subunit in T-cell receptor-triggered T-lymphocytes effector functions .
Author Sugiyama H, Chen P, Hunter M, Taffs R and Sitkovsky M.
Journal J. Biol. Chem. 267 (35), 25256-25263 (1992)
Title The two forms of bovine heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase result from alternative splicing .
Author Rider MH, Vandamme J, Lebeau E, Vertommen D, Vidal H, Rousseau GG, Vandekerckhove J and Hue L.
Journal Biochem. J. 285 (PT 2), 405-411 (1992)
Title Mechanism of interferon action. cDNA structure and regulation of a novel splice-site variant of the catalytic subunit of human protein kinase A from interferon-treated human cells .
Author Thomis DC, Floyd-Smith G and Samuel CE.
Journal J. Biol. Chem. 267 (15), 10723-10728 (1992)
Title Sequence of two phosphorylated sites in the catalytic subunit of bovine cardiac muscle adenosine 3':5'-monophosphate-dependent protein kinase .
Author Shoji,S., Titani,K., Demaille,J.G. and Fischer,E.H.
Journal J. Biol. Chem. 254 (14), 6211-6214 (1979)
Title Direct phosphorylation of brain tyrosine hydroxylase by cyclic AMP-dependent protein kinase: mechanism of enzyme activation .
Author Joh,T.H., Park,D.H. and Reis,D.J.
Journal Proc. Natl. Acad. Sci. U.S.A. 75 (10), 4744-4748 (1978)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.