• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protein kinase C, beta (PRKCB), transcript variant 2, mRNA.


RefSeq Accession Definition Services Price Order
NM_002738 Homo sapiens protein kinase C, beta (PRKCB), transcript variant 2, mRNA. ORF Sequence $586.38
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002738.6, 197100031
Length 8014 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens protein kinase C, beta (PRKCB), transcript variant 2, mRNA.
Product protein kinase C beta type isoform 2
Comment

Summary: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This protein kinase has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption. Studies in mice also suggest that this kinase may also regulate neuronal functions and correlate fear-induced conflict behavior after stress. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) represents the longer transcript and encodes the longer isoform (2).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_002729.2
CDS 198..2219
Misc Feature(1)30..32
Misc Feature(2)30..32
Misc Feature(3)243..245
Misc Feature(4)243..245
Misc Feature(5)246..248
Misc Feature(6)306..455
Misc Feature(7)order(306..308,345..347,354..356,396..398,405..407,
Misc Feature(8)order(327..329,336..341,366..386)
Misc Feature(9)order(336..338,342..344)
Misc Feature(10)501..650
Misc Feature(11)order(501..503,540..542,549..551,591..593,600..602,
Misc Feature(12)order(522..524,531..536,561..581)
Misc Feature(13)order(531..533,537..539)
Misc Feature(14)672..1064
Misc Feature(15)order(756..758,774..776,933..935,939..941,957..959)
Misc Feature(16)1218..2186
Misc Feature(17)1221..1997
Misc Feature(18)order(1239..1253,1263..1265,1302..1304,1308..1310,
Misc Feature(19)order(1239..1244,1254..1256,1263..1265,1302..1304,
Misc Feature(20)order(1251..1253,1476..1478,1482..1484,1593..1595,
Misc Feature(21)1644..1715
Misc Feature(22)1695..1697
Misc Feature(23)2118..2120
Misc Feature(24)2118..2120
Misc Feature(25)2163..2180
Exon (1)1..370
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (2)371..402
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (3)403..485
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (4)486..597
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (5)598..726
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (6)727..883
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (7)884..1018
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (8)1019..1115
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (9)1116..1262
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (10)1263..1436
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (11)1437..1528
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (12)1529..1591
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (13)1592..1730
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (14)1731..1811
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (15)1812..1919
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (16)1920..2060
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Exon (17)2061..8014
Gene:PRKCB
Gene Synonym:PKC-beta; PKCB; PRKCB1; PRKCB2
Translation MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL SVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEE LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS FVNSEFLKPEVKS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
173+c, tdbSNP:188342168
211+a, cdbSNP:201366670
262+a, gdbSNP:200442462
276+a, cdbSNP:75964872
284+a, gdbSNP:146177740
359+c, tdbSNP:115667450
461+dbSNP:
461+c, tdbSNP:115750906
496+dbSNP:
496+g, tdbSNP:3729895
521+a, gdbSNP:116749372
690+dbSNP:
690+c, gdbSNP:199648786
710+c, tdbSNP:115645964
711+a, gdbSNP:200811816
719+c, tdbSNP:116345778
803+dbSNP:
803+c, tdbSNP:3729896
885+dbSNP:
885+c, gdbSNP:200005518
899+a, gdbSNP:114093019
911+a, gdbSNP:17847891
1046+dbSNP:
1046+c, tdbSNP:17847884
1078+a, gdbSNP:199901715
1090+a, gdbSNP:147975795
1103+a, gdbSNP:115598469
1117+dbSNP:
1117+c, gdbSNP:141851225
1127+c, tdbSNP:201781724
1142+a, gdbSNP:146104501
1147+c, tdbSNP:202044032
1159+c, tdbSNP:139055681
1178+a, gdbSNP:114856527
1192+c, gdbSNP:149128755
1217+c, tdbSNP:116346810
1226+c, tdbSNP:56041613
1288+dbSNP:
1288+c, gdbSNP:148312044
1301+c, tdbSNP:202161442
1302+a, gdbSNP:141758720
1347+a, gdbSNP:200238437
1374+g, tdbSNP:144767432
1388+c, tdbSNP:432998
1397+g, tdbSNP:141827066
1435+g, tdbSNP:201855972
1463+dbSNP:
1463+c, tdbSNP:55942437
1589+dbSNP:
1589+c, tdbSNP:200457901
1696+dbSNP:
1696+a, cdbSNP:111341519
1721+c, tdbSNP:17847876
1884+dbSNP:
1884+c, tdbSNP:17847879
1920+dbSNP:
1920+a, cdbSNP:201555288
1960+a, c, gdbSNP:35631544
1967+c, tdbSNP:3729904
1989+a, gdbSNP:114846751
2108+dbSNP:
2108+a, tdbSNP:149446950
2165+c, tdbSNP:143953612
2228+a, gdbSNP:199871261
2347+a, tdbSNP:3380
2366+c, gdbSNP:146020925
2397+a, gdbSNP:41280844
2433+a, gdbSNP:4787872
2474+c, tdbSNP:149339486
2476+c, tdbSNP:189252078
2603+c, tdbSNP:144672987
2605+c, tdbSNP:148546127
2610+a, gdbSNP:114644570
2688+a, gdbSNP:78674142
2795+a, gdbSNP:142859099
2822+c, tdbSNP:3785380
3000+c, tdbSNP:182199378
3016+c, tdbSNP:3785379
3027+a, gdbSNP:147723634
3043..3052+, aaaaaaaagadbSNP:146512733
3043+, tcttttttttdbSNP:3837785
3052..3061+, aaaaaaaaagdbSNP:72271620
3052+a, gdbSNP:79376982
3107+c, tdbSNP:3785378
3139+c, tdbSNP:56687328
3167+a, gdbSNP:185582992
3230+g, tdbSNP:116093872
3379+c, tdbSNP:140893375
3385+a, cdbSNP:71379853
3390+, adbSNP:59543980
3391+a, tdbSNP:79997806
3401+a, gdbSNP:116357421
3403+a, gdbSNP:76359194
3444+g, tdbSNP:78750834
3515+a, gdbSNP:8059889
3518+a, gdbSNP:113196567
3558+a, gdbSNP:190191882
3735+c, tdbSNP:147946613
3757+a, gdbSNP:181718271
3778+, cdbSNP:35860232
3784+a, gdbSNP:185391750
3810+a, gdbSNP:41303765
3844+a, gdbSNP:75859222
3850+c, tdbSNP:112729951
3858+c, gdbSNP:140599804
3971+c, tdbSNP:113823327
3983+c, tdbSNP:190250028
4021+c, tdbSNP:114738789
4046+a, cdbSNP:181254533
4055+, cdbSNP:138855260
4056+c, tdbSNP:185977261
4178+a, tdbSNP:114136375
4290+c, gdbSNP:114638203
4319+a, gdbSNP:150101137
4399+a, cdbSNP:73550432
4405+a, gdbSNP:145450586
4475+a, gdbSNP:41309270
4497+a, tdbSNP:41311262
4504+a, gdbSNP:3209801
4508+a, gdbSNP:1131276
4511+a, gdbSNP:1131277
4512+a, tdbSNP:190798839
4561+, adbSNP:145016072
4585+c, gdbSNP:2021847
4661+a, gdbSNP:148858748
4705+a, gdbSNP:145309658
4752+g, tdbSNP:41313541
4857..4858+, cdbSNP:34197974
5055+a, cdbSNP:34097947
5185+c, tdbSNP:138047682
5268+c, tdbSNP:140957380
5275+g, tdbSNP:41311260
5283+a, cdbSNP:41311258
5377+a, gdbSNP:183896121
5424+c, tdbSNP:144891284
5493+a, tdbSNP:188939352
5715+c, gdbSNP:77825011
5734+a, gdbSNP:138780084
5740+a, gdbSNP:28552982
5781+c, tdbSNP:41303763
5797+a, gdbSNP:150831990
5891+a, gdbSNP:2239338
5924+a, cdbSNP:73550434
5946..5947+, gdbSNP:34630014
5967+c, gdbSNP:2239339
6022+g, tdbSNP:138123553
6052..6053+, gadbSNP:75695646
6053..6054+, gadbSNP:68056200
6058..6059+, gadbSNP:34045233
6082+c, gdbSNP:147259878
6085+c, gdbSNP:140931038
6099+c, tdbSNP:191748340
6139+c, gdbSNP:35434839
6226+c, tdbSNP:41311256
6285+a, tdbSNP:411103
6319+a, gdbSNP:11865035
6332+c, tdbSNP:8056058
6347+c, gdbSNP:3087957
6400+a, gdbSNP:148593800
6496+c, gdbSNP:113354788
6517+a, gdbSNP:183148409
6591..6592+, adbSNP:139806286
6648..6649+, ttttg, ttttgttttgttttg, ttttgttttgttttgttttgdbSNP:10639027
6648+c, gdbSNP:199618218
6649..6650+, ttttgdbSNP:35423969
6652..6653+, tgtttdbSNP:35889059
6653..6654+, gttttdbSNP:72080067
6658..6659+, gttttgttttdbSNP:71907097
6665..6666+, ttgttttgttdbSNP:10681565
6666..6667+, tgttt, ttgttttgttdbSNP:10681566
6677..6678+, gtttt, gttttgttttgttttdbSNP:10657133
6733..6734+, tagatdbSNP:138369749
6734..6735+, gattadbSNP:201843272
6734+a, tdbSNP:111528401
6737..6738+, tagatdbSNP:3216342
6737+c, tdbSNP:77746351
6738..6739+, tagatdbSNP:35283079
6762+a, gdbSNP:2239340
6773+g, tdbSNP:187559261
6896+a, gdbSNP:191675978
6915+a, gdbSNP:184182024
6970+a, gdbSNP:78946887
6985+c, tdbSNP:397299
7058..7059+a, c, gdbSNP:395078
7058+, adbSNP:200055220
7059..7060+, cc, ccacdbSNP:67800762
7059+a, cdbSNP:28605861
7060..7063+, cadbSNP:34565623
7060..7061+, cadbSNP:5816244
7061..7062+, acacdbSNP:71753246
7063+, adbSNP:34377767
7066..7067+, acacdbSNP:10655858
7067..7068+, cacadbSNP:10645988
7068..7069+, acdbSNP:10657134
7114..7115+, ggdbSNP:201572518
7330+c, tdbSNP:3729908
7334+a, c, gdbSNP:41278144
7344+a, gdbSNP:200017388
7360+c, gdbSNP:202022036
7426+c, tdbSNP:148637931
7494+c, tdbSNP:142427207
7531+c, tdbSNP:424741
7534+c, gdbSNP:140062455
7607+a, gdbSNP:187700395
7630+a, gdbSNP:113336763
7669+c, tdbSNP:192474372
7700+c, gdbSNP:185685652
7713+a, gdbSNP:190510502
7789+c, tdbSNP:181492069
7904+c, tdbSNP:144042856
7931..7932+, tdbSNP:34526646
7942+c, tdbSNP:1063471
7955+c, tdbSNP:146441057
Gene SymbolPRKCB
Gene SynonymPKC-beta; PKCB; PRKCB1; PRKCB2
Chromosome16
Locus Map16p11.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002738 Homo sapiens protein kinase C, beta (PRKCB), transcript variant 2, mRNA. Full Length Quote
ORF Sequence $586.38
NM_212535 Homo sapiens protein kinase C, beta (PRKCB), transcript variant 1, mRNA. Full Length $786.19
ORF Sequence $584.64
Title Protein kinase c-beta-dependent activation of NF-kappaB in stromal cells is indispensable for the survival of chronic lymphocytic leukemia B cells in vivo .
Author Lutzny,G., Kocher,T., Schmidt-Supprian,M., Rudelius,M., Klein-Hitpass,L., Finch,A.J., Durig,J., Wagner,M., Haferlach,C., Kohlmann,A., Schnittger,S., Seifert,M., Wanninger,S., Zaborsky,N., Oostendorp,R., Ruland,J., Leitges,M., Kuhnt,T., Schafer,Y., Lampl,B., Peschel,C., Egle,A. and Ringshausen,I.
Journal Cancer Cell 23 (1), 77-92 (2013)
Title Protein kinase C-beta contributes to impaired endothelial insulin signaling in humans with diabetes mellitus .
Author Tabit,C.E., Shenouda,S.M., Holbrook,M., Fetterman,J.L., Kiani,S., Frame,A.A., Kluge,M.A., Held,A., Dohadwala,M.M., Gokce,N., Farb,M.G., Rosenzweig,J., Ruderman,N., Vita,J.A. and Hamburg,N.M.
Journal Circulation 127 (1), 86-95 (2013)
Title PROX1 overexpression inhibits protein kinase C beta II transcription through promoter DNA methylation .
Author Hagiwara,K., Ito,H., Murate,T., Miyata,Y., Ohashi,H. and Nagai,H.
Journal Genes Chromosomes Cancer 51 (11), 1024-1036 (2012)
Title Estrogen receptor-alpha, RBCK1, and protein kinase C beta 1 cooperate to regulate estrogen receptor-alpha gene expression .
Author Gustafsson Sheppard,N., Heldring,N. and Dahlman-Wright,K.
Journal J. Mol. Endocrinol. 49 (3), 277-287 (2012)
Title Targeting the EWSR1-FLI1 oncogene-induced protein kinase PKC-beta abolishes ewing sarcoma growth .
Author Surdez,D., Benetkiewicz,M., Perrin,V., Han,Z.Y., Pierron,G., Ballet,S., Lamoureux,F., Redini,F., Decouvelaere,A.V., Daudigeos-Dubus,E., Geoerger,B., de Pinieux,G., Delattre,O. and Tirode,F.
Journal Cancer Res. 72 (17), 4494-4503 (2012)
Title Cloning and characterization of the major promoter of the human protein kinase C beta gene. Regulation by phorbol esters .
Author Obeid,L.M., Blobe,G.C., Karolak,L.A. and Hannun,Y.A.
Journal J. Biol. Chem. 267 (29), 20804-20810 (1992)
Title Differential regulation of glycogen synthase kinase-3 beta by protein kinase C isotypes .
Author Goode,N., Hughes,K., Woodgett,J.R. and Parker,P.J.
Journal J. Biol. Chem. 267 (24), 16878-16882 (1992)
Title Identification of the cAMP-dependent protein kinase and protein kinase C phosphorylation sites within the major intracellular domains of the beta 1, gamma 2S, and gamma 2L subunits of the gamma-aminobutyric acid type A receptor .
Author Moss,S.J., Doherty,C.A. and Huganir,R.L.
Journal J. Biol. Chem. 267 (20), 14470-14476 (1992)
Title Down-regulation of human protein kinase C alpha is associated with terminal neutrophil differentiation .
Author Devalia,V., Thomas,N.S., Roberts,P.J., Jones,H.M. and Linch,D.C.
Journal Blood 80 (1), 68-76 (1992)
Title Positive and negative regulation of the transcription of the human protein kinase C beta gene .
Author Niino,Y.S., Ohno,S. and Suzuki,K.
Journal J. Biol. Chem. 267 (9), 6158-6163 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878