• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu22909 Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu22909C Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002750.3, 513788275
Length 1155 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1, mRNA.
Product mitogen-activated protein kinase 8 isoform alpha1
Comment

Summary: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF-alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. Five alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jun 2013].


Transcript Variant: This variant (JNK1-a1) uses a different acceptor splice site in the last coding exon compared to transcript variant JNK1-a2, resulting in a frameshift and a shorter isoform (JNK1 alpha1) with a different C-terminus, compared to isoform JNK1 alpha2. The JNK1-a1 variant differs from the JNK1-b1 variant in the use of an alternate internal coding exon of the same length. Thus, JNK1 alpha1 isoform is the same length as JNK1 beta1 isoform, with a few aa difference in an internal protein segment.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002741.1
CDS 50..1204
Misc Feature(1)35..37
Misc Feature(2)74..1129
Misc Feature(3)74..1129
Misc Feature(4)125..1012
Misc Feature(5)order(143..163,167..169,206..208,212..214,263..265,
Misc Feature(6)order(143..163,167..169,206..208,212..214,305..307,
Misc Feature(7)order(263..265,395..397,500..502,506..508,563..565,
Misc Feature(8)order(383..385,401..403,428..430,437..439,524..538,
Misc Feature(9)order(551..583,596..619)
Misc Feature(10)596..604
Misc Feature(11)596..598
Misc Feature(12)596..598
Misc Feature(13)602..604
Misc Feature(14)602..604
Misc Feature(15)602..604
Exon (1)1..171
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (2)172..301
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (3)302..360
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (4)361..499
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (5)500..665
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (6)666..737
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (7)738..920
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (8)921..1045
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (9)1046..1109
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (10)1110..1187
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (11)1188..5669
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Translation MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV MDLEERTKNGVIRGQPSPLAQVQQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
7+dbSNP:
7+a, gdbSNP:200375054
28+a, gdbSNP:199529538
76+g, tdbSNP:150753150
97+a, gdbSNP:137900446
113+a, gdbSNP:370411166
157+c, tdbSNP:149467709
173+dbSNP:
173+a, gdbSNP:200350498
185+a, gdbSNP:143875999
229+a, gdbSNP:139947100
325+dbSNP:
325+c, tdbSNP:370630557
330+c, gdbSNP:200881923
340+c, tdbSNP:55740545
397+dbSNP:
397+c, tdbSNP:368826984
518+dbSNP:
518+a, gdbSNP:368198154
559+c, tdbSNP:199940599
575+g, tdbSNP:372126348
598+a, gdbSNP:367750354
610+a, gdbSNP:143505474
614+c, tdbSNP:202013888
631+c, tdbSNP:55984396
667+dbSNP:
667+g, tdbSNP:1126585
679+a, tdbSNP:1126586
682+a, gdbSNP:371770117
691+c, tdbSNP:1126587
716+a, gdbSNP:1126588
718+c, gdbSNP:1126589
719+c, gdbSNP:1126590
721+c, gdbSNP:1126591
726+c, tdbSNP:376010774
730+a, tdbSNP:1126592
732+c, gdbSNP:1126593
795+dbSNP:
795+c, tdbSNP:377156368
844+a, gdbSNP:201458109
854+c, tdbSNP:199509878
961+dbSNP:
961+a, tdbSNP:45505100
997+c, gdbSNP:373006192
1006+a, gdbSNP:147168789
1014+a, gdbSNP:142342900
1093+dbSNP:
1093+a, cdbSNP:55859048
1118+dbSNP:
1118+c, tdbSNP:201417282
1129+c, tdbSNP:368000003
1131+c, tdbSNP:371493413
1142+a, gdbSNP:45483593
1148+a, gdbSNP:28395809
1150+c, gdbSNP:201573286
1170+c, gdbSNP:151285118
1233+a, gdbSNP:142330800
1236+a, gdbSNP:149971269
1244+a, gdbSNP:367599489
1307+c, tdbSNP:147673874
1313+a, cdbSNP:142606131
1352+c, tdbSNP:200811159
1355+g, tdbSNP:377754613
1376+c, tdbSNP:371191645
1377+g, tdbSNP:192957799
1492+a, gdbSNP:1062225
1528+c, tdbSNP:184169437
1548..1549+, tdbSNP:200672731
1556..1557+, tdbSNP:112248653
1625+a, tdbSNP:76626172
1656+a, tdbSNP:146916293
1688+c, tdbSNP:187779968
1701+c, gdbSNP:191604375
1774..1775+, acdbSNP:139274132
1775+c, tdbSNP:201539690
1777+a, gdbSNP:184872933
1836+g, tdbSNP:9284
1887+g, tdbSNP:76109261
1945+a, gdbSNP:139336823
1971+c, tdbSNP:375126595
2036+g, tdbSNP:141758313
2037+a, gdbSNP:113978751
2099+a, gdbSNP:371660031
2215+a, cdbSNP:76130808
2227..2229+, actdbSNP:367764481
2234+c, tdbSNP:189497037
2281+a, cdbSNP:181440985
2403..2404+, gdbSNP:34949831
2459+c, tdbSNP:111883599
2515+a, tdbSNP:367923445
2559+a, gdbSNP:73293538
2564+a, gdbSNP:114883745
2603+c, tdbSNP:113767329
2607+a, gdbSNP:118023498
2618+a, gdbSNP:185363879
2682+c, tdbSNP:8428
2699+c, tdbSNP:12269230
2736+c, tdbSNP:78986194
2752+c, tdbSNP:73293542
2882+a, tdbSNP:189424334
2968+a, cdbSNP:73293545
3067+a, gdbSNP:181230780
3096+c, gdbSNP:370067412
3104+g, tdbSNP:186487541
3135+a, gdbSNP:138542106
3234+c, gdbSNP:41281985
3398+a, gdbSNP:377192131
3416+g, tdbSNP:139368250
3474+c, gdbSNP:149936568
complement(3544)-g, adbSNP:144001390
3593+c, tdbSNP:191027325
3663+a, tdbSNP:79326832
3672..3673+, tdbSNP:59572419
3795+c, gdbSNP:72794390
3905+g, tdbSNP:377506835
3921+g, tdbSNP:181007127
3945+a, gdbSNP:142885467
4023+g, tdbSNP:78087466
4140+a, gdbSNP:376258821
4262+c, gdbSNP:142367490
4283+c, tdbSNP:144576948
4287+a, cdbSNP:147957206
4360+a, gdbSNP:41281987
4418+a, gdbSNP:11101321
4426..4427+, tdbSNP:113244356
4496+c, tdbSNP:367982902
4618+c, tdbSNP:140590526
4637+a, gdbSNP:75124279
4703+a, gdbSNP:114904314
4737+a, gdbSNP:186105336
4840+c, tdbSNP:41281989
4845+c, gdbSNP:190908895
4903..4905+, aatdbSNP:371168022
5036+a, gdbSNP:73293546
5113+a, gdbSNP:143103875
5133+c, tdbSNP:2377350
5134+a, gdbSNP:374580063
5161+a, cdbSNP:112893609
5228+c, tdbSNP:182787752
5316+a, cdbSNP:188723855
5322+a, gdbSNP:138582971
5335+c, gdbSNP:115095528
complement(5388)-t, cdbSNP:141542501
5394+a, cdbSNP:370768243
5421+c, tdbSNP:191727003
5427+c, tdbSNP:368172662
5457+a, cdbSNP:145193085
5477+c, gdbSNP:183263020
5533+a, tdbSNP:11598320
5583+a, cdbSNP:1048693
5611+g, tdbSNP:74409873
Gene SymbolMAPK8
Gene SynonymJNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Chromosome10
Locus Map10q11.22
Title Convergent regulation of the lysosomal two-pore channel-2 by Mg(2)(+), NAADP, PI(3,5)P(2) and multiple protein kinases .
Author Jha A, Ahuja M, Patel S, Brailoiu E and Muallem S.
Journal EMBO J. 33 (5), 501-511 (2014)
Title Intracellular mobility and nuclear trafficking of the stress-activated kinase JNK1 are impeded by hyperosmotic stress .
Author Misheva M, Kaur G, Ngoei KR, Yeap YY, Ng IH, Wagstaff KM, Ng DC, Jans DA and Bogoyevitch MA.
Journal Biochim. Biophys. Acta 1843 (2), 253-264 (2014)
Title Alkylphosphocholines and curcumin induce programmed cell death in cutaneous T-cell lymphoma cell lines .
Author Yosifov DY, Kaloyanov KA, Guenova ML, Prisadashka K, Balabanova MB, Berger MR and Konstantinov SM.
Journal Leuk. Res. 38 (1), 49-56 (2014)
Title MUC1 activates JNK1 and inhibits apoptosis under genotoxic stress .
Author Chen Q, Li D, Ren J, Li C and Xiao ZX.
Journal Biochem. Biophys. Res. Commun. 440 (1), 179-183 (2013)
Title Asymmetric dimethylarginine attenuates serum starvation-induced apoptosis via suppression of the Fas (APO-1/CD95)/JNK (SAPK) pathway .
Author Li H, Zhou Y, Zhao A, Qiu Y, Xie G, Jiang Q, Zheng X, Zhong W, Sun X, Zhou Z and Jia W.
Journal Cell Death Dis 4, E830 (2013)
Title Ionizing radiation stimulates a Grb2-mediated association of the stress-activated protein kinase with phosphatidylinositol 3-kinase .
Author Kharbanda S, Saleem A, Shafman T, Emoto Y, Taneja N, Rubin E, Weichselbaum R, Woodgett J, Avruch J and Kyriakis J.
Journal J. Biol. Chem. 270 (32), 18871-18874 (1995)
Title ATF-2 is preferentially activated by stress-activated protein kinases to mediate c-jun induction in response to genotoxic agents .
Author van Dam H, Wilhelm D, Herr I, Steffen A, Herrlich P and Angel P.
Journal EMBO J. 14 (8), 1798-1811 (1995)
Title ATF-2 contains a phosphorylation-dependent transcriptional activation domain .
Author Livingstone C, Patel G and Jones N.
Journal EMBO J. 14 (8), 1785-1797 (1995)
Title Independent human MAP-kinase signal transduction pathways defined by MEK and MKK isoforms .
Author Derijard B, Raingeaud J, Barrett T, Wu IH, Han J, Ulevitch RJ and Davis RJ.
Journal Science 267 (5198), 682-685 (1995)
Title A phosphorylation site located in the NH2-terminal domain of c-Myc increases transactivation of gene expression .
Author Seth A, Alvarez E, Gupta S and Davis RJ.
Journal J. Biol. Chem. 266 (35), 23521-23524 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.