Sequence in raw or FASTA format:
Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1, mRNA.
| RefSeq Version | NM_002750.2, 20986493 |
| Length | 1417 bp |
| Structure | linear |
| Update Date | 17-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1, mRNA. |
| Product | mitogen-activated protein kinase 8 isoform JNK1 alpha1 |
| Comment | Summary: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF-alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]. Transcript Variant: This variant (JNK1-a1) uses a different acceptor splice site in the last coding exon compared to transcript variant JNK1-a2, resulting in a frameshift and a shorter isoform (JNK1 alpha1) with a different C-terminus, compared to isoform JNK1 alpha2. The JNK1-a1 variant differs from the JNK1-b1 variant in the use of an alternate internal coding exon of the same length. Thus, JNK1 alpha1 isoform is the same length as JNK1 beta1 isoform, with a few aa difference in an internal protein segment. |
| RefSeq | NP_002741.1 |
| CDS | 18..1172 | Exon (1) | 1..139 | Exon (2) | 1..139 | Exon (3) | 140..269 | Exon (4) | 270..328 | Exon (5) | 329..467 | Exon (6) | 468..633 | Exon (7) | 634..705 | Exon (8) | 706..888 | Exon (9) | 889..1013 | Exon (10) | 1014..1077 | Exon (11) | 1078..1155 | Exon (12) | 1156..1417 |
| Translation | MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLAQVQQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 308 | + | c, t | dbSNP:55740545 |
| 599 | + | c, t | dbSNP:55984396 |
| 647 | + | a, t | dbSNP:1126586 |
| 659 | + | c, t | dbSNP:1126587 |
| 684 | + | a, g | dbSNP:1126588 |
| 686 | + | c, g | dbSNP:1126589 |
| 687 | + | c, g | dbSNP:1126590 |
| 698 | + | a, t | dbSNP:1126592 |
| 700 | + | c, g | dbSNP:1126593 |
| 774 | + | a, c | dbSNP:78906174 |
| 929 | + | a, t | dbSNP:45505100 |
| 1061 | + | a, c | dbSNP:55859048 |
| 1110 | + | a, g | dbSNP:45483593 |
| 1116 | + | a, g | dbSNP:28395809 |
| Gene Symbol | MAPK8 |
| Gene Synonym | JNK; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1 |
| Chromosome | 10 |
| Locus Map | 10q11.22 |
| All Transcripts | NM_002750 , NM_139046 , NM_139047 , NM_139049 |
| Title | JNK1 is required for lentivirus entry and gene transfer . |
| Author | Lee,M.H., Padmashali,R. and Andreadis,S.T. |
| Journal | J. Virol. 85 (6), 2657-2665 (2011) |
| Title | Ursolic acid, a pentacyclin triterpene, potentiates TRAIL-induced apoptosis through p53-independent up-regulation of death receptors: evidence for the role of reactive oxygen species and JNK . |
| Author | Prasad,S., Yadav,V.R., Kannappan,R. and Aggarwal,B.B. |
| Journal | J. Biol. Chem. 286 (7), 5546-5557 (2011) |
| Title | Androgen receptor-mediated regulation of the anti-atherogenic enzyme CYP27A1 involves the JNK/c-jun pathway . |
| Author | Norlin,M., Pettersson,H., Tang,W. and Wikvall,K. |
| Journal | Arch. Biochem. Biophys. 506 (2), 236-241 (2011) |
| Title | IL-17R activation of human periodontal ligament fibroblasts induces IL-23 p19 production: Differential involvement of NF-kappaB versus JNK/AP-1 pathways . |
| Author | Zhu,L., Wu,Y., Wei,H., Xing,X., Zhan,N., Xiong,H. and Peng,B. |
| Journal | Mol. Immunol. 48 (4), 647-656 (2011) |
| Title | c-Jun NH2-terminal kinase-dependent upregulation of DR5 mediates cooperative induction of apoptosis by perifosine and TRAIL . |
| Author | Fu,L., Lin,Y.D., Elrod,H.A., Yue,P., Oh,Y., Li,B., Tao,H., Chen,G.Z., Shin,D.M., Khuri,F.R. and Sun,S.Y. |
| Journal | Mol. Cancer 9, 315 (2010) |
| Title | Ionizing radiation stimulates a Grb2-mediated association of the stress-activated protein kinase with phosphatidylinositol 3-kinase . |
| Author | Kharbanda,S., Saleem,A., Shafman,T., Emoto,Y., Taneja,N., Rubin,E., Weichselbaum,R., Woodgett,J., Avruch,J., Kyriakis,J. et al. |
| Journal | J. Biol. Chem. 270 (32), 18871-18874 (1995) |
| Title | ATF-2 is preferentially activated by stress-activated protein kinases to mediate c-jun induction in response to genotoxic agents . |
| Author | van Dam,H., Wilhelm,D., Herr,I., Steffen,A., Herrlich,P. and Angel,P. |
| Journal | EMBO J. 14 (8), 1798-1811 (1995) |
| Title | ATF-2 contains a phosphorylation-dependent transcriptional activation domain . |
| Author | Livingstone,C., Patel,G. and Jones,N. |
| Journal | EMBO J. 14 (8), 1785-1797 (1995) |
| Title | Independent human MAP-kinase signal transduction pathways defined by MEK and MKK isoforms . |
| Author | Derijard,B., Raingeaud,J., Barrett,T., Wu,I.H., Han,J., Ulevitch,R.J. and Davis,R.J. |
| Journal | Science 267 (5198), 682-685 (1995) |
| Title | A phosphorylation site located in the NH2-terminal domain of c-Myc increases transactivation of gene expression . |
| Author | Seth,A., Alvarez,E., Gupta,S. and Davis,R.J. |
| Journal | J. Biol. Chem. 266 (35), 23521-23524 (1991) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |