• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1, mRNA.


RefSeq Accession Definition Services Price Order
NM_002750 Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1, mRNA. ORF Sequence $334.95
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002750.2, 20986493
Length 1417 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1, mRNA.
Product mitogen-activated protein kinase 8 isoform alpha1
Comment

Summary: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF-alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (JNK1-a1) uses a different acceptor splice site in the last coding exon compared to transcript variant JNK1-a2, resulting in a frameshift and a shorter isoform (JNK1 alpha1) with a different C-terminus, compared to isoform JNK1 alpha2. The JNK1-a1 variant differs from the JNK1-b1 variant in the use of an alternate internal coding exon of the same length. Thus, JNK1 alpha1 isoform is the same length as JNK1 beta1 isoform, with a few aa difference in an internal protein segment.

RefSeq NP_002741.1
CDS 18..1172
Misc Feature(1)3..5
Misc Feature(2)3..5
Misc Feature(3)42..1097
Misc Feature(4)42..1097
Misc Feature(5)93..980
Misc Feature(6)order(111..131,135..137,174..176,180..182,231..233,
Misc Feature(7)order(111..131,135..137,174..176,180..182,273..275,
Misc Feature(8)order(231..233,363..365,468..470,474..476,531..533,
Misc Feature(9)order(351..353,369..371,396..398,405..407,492..506,
Misc Feature(10)order(519..551,564..587)
Misc Feature(11)564..572
Misc Feature(12)564..566
Misc Feature(13)564..566
Misc Feature(14)570..572
Misc Feature(15)570..572
Misc Feature(16)570..572
Misc Feature(17)1156..1160
Misc Feature(18)1156..1160
Exon (1)1..139
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (2)140..269
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (3)270..328
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (4)329..467
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (5)468..633
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (6)634..705
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (7)706..888
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (8)889..1013
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (9)1014..1077
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (10)1078..1155
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Exon (11)1156..1417
Gene:MAPK8
Gene Synonym:JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Translation MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV MDLEERTKNGVIRGQPSPLAQVQQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
44+g, tdbSNP:150753150
65+a, gdbSNP:137900446
125+c, tdbSNP:149467709
141+dbSNP:
141+a, gdbSNP:200350498
153+a, gdbSNP:143875999
197+a, gdbSNP:139947100
298+dbSNP:
298+c, gdbSNP:200881923
308+c, tdbSNP:55740545
527+dbSNP:
527+c, tdbSNP:199940599
578+a, gdbSNP:143505474
582+c, tdbSNP:202013888
599+c, tdbSNP:55984396
635+dbSNP:
635+g, tdbSNP:1126585
647+a, tdbSNP:1126586
659+c, tdbSNP:1126587
684+a, gdbSNP:1126588
686+c, gdbSNP:1126589
687+c, gdbSNP:1126590
689+c, gdbSNP:1126591
698+a, tdbSNP:1126592
700+c, gdbSNP:1126593
812+dbSNP:
812+a, gdbSNP:201458109
822+c, tdbSNP:199509878
929+dbSNP:
929+a, tdbSNP:45505100
974+a, gdbSNP:147168789
982+a, gdbSNP:142342900
1061+dbSNP:
1061+a, cdbSNP:55859048
1086+dbSNP:
1086+c, tdbSNP:201417282
1110+a, gdbSNP:45483593
1116+a, gdbSNP:28395809
1118+c, gdbSNP:201573286
1138+c, gdbSNP:151285118
1201+a, gdbSNP:142330800
1204+a, gdbSNP:149971269
1275+c, tdbSNP:147673874
1281+a, cdbSNP:142606131
1320+c, tdbSNP:200811159
1345+g, tdbSNP:192957799
Gene SymbolMAPK8
Gene SynonymJNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Chromosome10
Locus Map10q11.22
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002750 Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1, mRNA. Full Length $410.93
ORF Sequence $334.95
NM_139046 Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b1, mRNA. Full Length $410.93
ORF Sequence $334.95
NM_139047 Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b2, mRNA. Full Length $409.48
ORF Sequence $372.36
NM_139049 Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a2, mRNA. Full Length $409.48
ORF Sequence $372.36
Title Therapeutic effect of c-Jun N-terminal kinase inhibition on pancreatic cancer .
Author Takahashi,R., Hirata,Y., Sakitani,K., Nakata,W., Kinoshita,H., Hayakawa,Y., Nakagawa,H., Sakamoto,K., Hikiba,Y., Ijichi,H., Moses,H.L., Maeda,S. and Koike,K.
Journal Cancer Sci. 104 (3), 337-344 (2013)
Title Hyperactivated JNK is a therapeutic target in pVHL-deficient renal cell carcinoma .
Author An,J., Liu,H., Magyar,C.E., Guo,Y., Veena,M.S., Srivatsan,E.S., Huang,J. and Rettig,M.B.
Journal Cancer Res. 73 (4), 1374-1385 (2013)
Title c-Jun N-terminal kinase is upregulated in patients with hypospadias .
Author Li,M., Qiu,L., Lin,T., He,D., Hua,Y., Yuan,X., Liu,X. and Wei,G.
Journal Urology 81 (1), 178-183 (2013)
Title Differential roles of JNK, ERK1/2, and p38 mitogen-activated protein kinases on endothelial cell tissue repair functions in response to tumor necrosis factor-alpha .
Author Kanaji,N., Nelson,A., Wang,X., Sato,T., Nakanishi,M., Gunji,Y., Basma,H., Michalski,J., Farid,M., Rennard,S.I. and Liu,X.
Journal J. Vasc. Res. 50 (2), 145-156 (2013)
Title Glucagon-like peptide-1 counteracts oxidative stress-dependent apoptosis of human cardiac progenitor cells by inhibiting the activation of the c-Jun N-terminal protein kinase signaling pathway .
Author Laviola,L., Leonardini,A., Melchiorre,M., Orlando,M.R., Peschechera,A., Bortone,A., Paparella,D., Natalicchio,A., Perrini,S. and Giorgino,F.
Journal Endocrinology 153 (12), 5770-5781 (2012)
Title Ionizing radiation stimulates a Grb2-mediated association of the stress-activated protein kinase with phosphatidylinositol 3-kinase .
Author Kharbanda,S., Saleem,A., Shafman,T., Emoto,Y., Taneja,N., Rubin,E., Weichselbaum,R., Woodgett,J., Avruch,J., Kyriakis,J. et al.
Journal J. Biol. Chem. 270 (32), 18871-18874 (1995)
Title ATF-2 is preferentially activated by stress-activated protein kinases to mediate c-jun induction in response to genotoxic agents .
Author van Dam,H., Wilhelm,D., Herr,I., Steffen,A., Herrlich,P. and Angel,P.
Journal EMBO J. 14 (8), 1798-1811 (1995)
Title ATF-2 contains a phosphorylation-dependent transcriptional activation domain .
Author Livingstone,C., Patel,G. and Jones,N.
Journal EMBO J. 14 (8), 1785-1797 (1995)
Title Independent human MAP-kinase signal transduction pathways defined by MEK and MKK isoforms .
Author Derijard,B., Raingeaud,J., Barrett,T., Wu,I.H., Han,J., Ulevitch,R.J. and Davis,R.J.
Journal Science 267 (5198), 682-685 (1995)
Title A phosphorylation site located in the NH2-terminal domain of c-Myc increases transactivation of gene expression .
Author Seth,A., Alvarez,E., Gupta,S. and Davis,R.J.
Journal J. Biol. Chem. 266 (35), 23521-23524 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878