• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA.


RefSeq Accession Definition Services Price Order
NM_002769 Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA. ORF Sequence $215.76
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002769.4, 310923201
Length 831 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA.
Product trypsin-1 preproprotein
Comment

Summary: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. [provided by RefSeq, Jul 2008].

RefSeq NP_002760.1
CDS 18..761
Misc Feature(1)87..743
Misc Feature(2)87..89
Misc Feature(3)order(204..206,336..338,615..617)
Misc Feature(4)381..383
Misc Feature(5)477..479
Misc Feature(6)477..479
Misc Feature(7)order(597..599,660..662,666..668)
Misc Feature(8)597..599
Exon (1)1..57
Gene:PRSS1
Gene Synonym:TRP1; TRY1; TRY4; TRYP1
Exon (2)58..217
Gene:PRSS1
Gene Synonym:TRP1; TRY1; TRY4; TRYP1
Exon (3)218..471
Gene:PRSS1
Gene Synonym:TRP1; TRY1; TRY4; TRYP1
Exon (4)472..608
Gene:PRSS1
Gene Synonym:TRP1; TRY1; TRY4; TRYP1
Exon (5)609..817
Gene:PRSS1
Gene Synonym:TRP1; TRY1; TRY4; TRYP1
Translation MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK NTIAANS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
23+a, tdbSNP:140591237
25+c, tdbSNP:143974175
29+c, tdbSNP:146454344
40+c, tdbSNP:201027769
61+dbSNP:
61+c, gdbSNP:200665515
64+c, tdbSNP:202003805
85+a, gdbSNP:111033567
89+c, tdbSNP:151065614
90+a, gdbSNP:148057550
103+a, tdbSNP:111033566
108+a, gdbSNP:700323
163+g, tdbSNP:138464021
175+a, tdbSNP:149246646
178+a, gdbSNP:144422014
179+c, g, tdbSNP:148440491
183+c, tdbSNP:147366981
201+a, gdbSNP:137988652
202+c, gdbSNP:149455681
203+c, tdbSNP:199713773
204+c, tdbSNP:11553851
219+dbSNP:
219+c, tdbSNP:145867820
251+c, tdbSNP:200801370
252+a, gdbSNP:111033564
260+c, gdbSNP:142476093
273+c, tdbSNP:146398318
281+c, gdbSNP:199836666
296+c, tdbSNP:139664510
300+c, tdbSNP:201775810
308+c, gdbSNP:200763933
315+a, gdbSNP:199507985
330+a, gdbSNP:200254850
342+a, cdbSNP:201165989
364+a, c, gdbSNP:199769221
378+a, gdbSNP:199422123
381+c, tdbSNP:111033568
382..383+at, gcdbSNP:267606982
382+a, gdbSNP:111033565
383+c, tdbSNP:201487096
384+a, gdbSNP:144403091
390+a, gdbSNP:200976326
405+c, tdbSNP:11553845
406+c, tdbSNP:193922655
407+c, tdbSNP:146564937
408+a, g, tdbSNP:141011596
410+c, tdbSNP:200699755
413+c, tdbSNP:199931737
415+c, gdbSNP:193922656
420+a, gdbSNP:199637670
427+c, tdbSNP:117497341
429+a, gdbSNP:11553849
434+c, tdbSNP:141847266
460+c, tdbSNP:149770610
461+c, g, tdbSNP:11553844
470+c, tdbSNP:147765409
474+dbSNP:
474+c, gdbSNP:61735002
485+c, tdbSNP:146076691
486+a, gdbSNP:200890507
497+c, tdbSNP:200267714
503+a, gdbSNP:6666
511+c, tdbSNP:202228418
525+a, gdbSNP:201550522
529+a, gdbSNP:200973660
543+a, gdbSNP:11553847
559+a, gdbSNP:201719096
564+a, gdbSNP:200070487
568+a, gdbSNP:11553848
578+c, tdbSNP:1804561
585+g, tdbSNP:11553850
622+c, gdbSNP:199531292
634+c, gdbSNP:150930992
638+c, tdbSNP:146995038
640+c, gdbSNP:189270875
642+c, gdbSNP:140793689
654+a, gdbSNP:200902389
659+a, cdbSNP:141697925
670+a, tdbSNP:199878511
722+c, tdbSNP:1042921
726+a, gdbSNP:150083974
728+a, cdbSNP:138362833
738+a, gdbSNP:141554682
755+a, gdbSNP:6667
Gene SymbolPRSS1
Gene SynonymTRP1; TRY1; TRY4; TRYP1
Chromosome7
Locus Map7q34
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002769 Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA. Full Length $240.99
ORF Sequence $215.76
Title Common genetic variants in the CLDN2 and PRSS1-PRSS2 loci alter risk for alcohol-related and sporadic pancreatitis .
Author Whitcomb,D.C., LaRusch,J., Krasinskas,A.M., Klei,L., Smith,J.P., Brand,R.E., Neoptolemos,J.P., Lerch,M.M., Tector,M., Sandhu,B.S., Guda,N.M., Orlichenko,L., Alkaade,S., Amann,S.T., Anderson,M.A., Baillie,J., Banks,P.A., Conwell,D., Cote,G.A., Cotton,P.B., DiSario,J., Farrer,L.A., Forsmark,C.E., Johnstone,M., Gardner,T.B., Gelrud,A., Greenhalf,W., Haines,J.L., Hartman,D.J., Hawes,R.A., Lawrence,C., Lewis,M., Mayerle,J., Mayeux,R., Melhem,N.M., Money,M.E., Muniraj,T., Papachristou,G.I., Pericak-Vance,M.A., Romagnuolo,J., Schellenberg,G.D., Sherman,S., Simon,P., Singh,V.P., Slivka,A., Stolz,D., Sutton,R., Weiss,F.U., Wilcox,C.M., Zarnescu,N.O., Wisniewski,S.R., O'Connell,M.R., Kienholz,M.L., Roeder,K., Barmada,M.M., Yadav,D. and Devlin,B.
Journal Nat. Genet. 44 (12), 1349-1354 (2012)
Title Screening of R122H and N29I mutations in the PRSS1 gene and N34S mutation in the SPINK1 gene in Mexican pediatric patients with acute and recurrent pancreatitis .
Author Sanchez-Ramirez,C.A., Flores-Martinez,S.E., Garcia-Zapien,A.G., Montero-Cruz,S.A., Larrosa-Haro,A. and Sanchez-Corona,J.
Journal Pancreas 41 (5), 707-711 (2012)
Title Increased activation of hereditary pancreatitis-associated human cationic trypsinogen mutants in presence of chymotrypsin C .
Author Szabo,A. and Sahin-Toth,M.
Journal J. Biol. Chem. 287 (24), 20701-20710 (2012)
Title Genetic prevalence and characteristics in children with recurrent pancreatitis .
Author Sultan,M., Werlin,S. and Venkatasubramani,N.
Journal J. Pediatr. Gastroenterol. Nutr. 54 (5), 645-650 (2012)
Title PRSS1 intron mutations in patients with pancreatic cancer and chronic pancreatitis .
Author Gao,F., Liu,Q.C., Zhang,S., Zhuang,Z.H., Lin,C.Z. and Lin,X.H.
Journal Mol Med Rep 5 (2), 449-451 (2012)
Title Isolation of a cDNA encoding a human serum marker for acute pancreatitis. Identification of pancreas-specific protein as pancreatic procarboxypeptidase B .
Author Yamamoto,K.K., Pousette,A., Chow,P., Wilson,H., el Shami,S. and French,C.K.
Journal J. Biol. Chem. 267 (4), 2575-2581 (1992)
Title Immunoreactive anionic and cationic trypsin in human serum .
Author Kimland,M., Russick,C., Marks,W.H. and Borgstrom,A.
Journal Clin. Chim. Acta 184 (1), 31-46 (1989)
Title The reactive site of human alpha 2-antiplasmin .
Author Shieh,B.H. and Travis,J.
Journal J. Biol. Chem. 262 (13), 6055-6059 (1987)
Title Cloning, characterization and nucleotide sequences of two cDNAs encoding human pancreatic trypsinogens .
Author Emi,M., Nakamura,Y., Ogawa,M., Yamamoto,T., Nishide,T., Mori,T. and Matsubara,K.
Journal Gene 41 (2-3), 305-310 (1986)
Title Chromosomal assignments of human genes for serine proteases trypsin, chymotrypsin B, and elastase .
Author Honey,N.K., Sakaguchi,A.Y., Quinto,C., MacDonald,R.J., Bell,G.I., Craik,C., Rutter,W.J. and Naylor,S.L.
Journal Somat. Cell Mol. Genet. 10 (4), 369-376 (1984)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878