• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19842 Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu19842C Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002769.4, 310923201
Length 744 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA.
Product trypsin-1 preproprotein
Comment

Summary: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. [provided by RefSeq, Jul 2008].

RefSeq NP_002760.1
CDS 18..761
Misc Feature(1)84..734
Misc Feature(2)87..743
Misc Feature(3)87..89
Misc Feature(4)order(204..206,336..338,615..617)
Misc Feature(5)381..383
Misc Feature(6)477..479
Misc Feature(7)477..479
Misc Feature(8)order(597..599,660..662,666..668)
Misc Feature(9)597..599
Exon (1)1..57
Gene:PRSS1
Gene Synonym:TRP1; TRY1; TRY4; TRYP1
Exon (2)58..217
Gene:PRSS1
Gene Synonym:TRP1; TRY1; TRY4; TRYP1
Exon (3)218..471
Gene:PRSS1
Gene Synonym:TRP1; TRY1; TRY4; TRYP1
Exon (4)472..608
Gene:PRSS1
Gene Synonym:TRP1; TRY1; TRY4; TRYP1
Exon (5)609..817
Gene:PRSS1
Gene Synonym:TRP1; TRY1; TRY4; TRYP1
Translation MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK NTIAANS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
8+dbSNP:
8+a, cdbSNP:369627514
23+a, tdbSNP:140591237
25+c, tdbSNP:374597855
40+c, tdbSNP:201027769
61+dbSNP:
61+c, gdbSNP:200665515
64+c, tdbSNP:202003805
82+a, gdbSNP:397507442
85+a, gdbSNP:111033567
88..89+, tgacaagatdbSNP:397507441
89+c, tdbSNP:372637371
103+a, c, tdbSNP:111033566
108+a, gdbSNP:700323
133+c, tdbSNP:397507439
138+c, tdbSNP:369646357
161+c, tdbSNP:372007913
163+g, tdbSNP:138464021
175+a, tdbSNP:149246646
178+a, gdbSNP:144422014
179+c, g, tdbSNP:148440491
183+c, tdbSNP:147366981
199+a, cdbSNP:370761165
202+c, gdbSNP:149455681
203+c, tdbSNP:199713773
204+c, tdbSNP:11553851
219+dbSNP:
219+c, tdbSNP:145867820
251+c, tdbSNP:200801370
252+a, gdbSNP:111033564
260+a, c, gdbSNP:142476093
264+c, gdbSNP:372411481
272+a, gdbSNP:376671702
273+c, tdbSNP:146398318
281+c, gdbSNP:199836666
287+a, gdbSNP:371037592
296+c, tdbSNP:139664510
300+c, tdbSNP:201775810
301+a, gdbSNP:375820192
308+c, gdbSNP:200763933
314+c, tdbSNP:373659879
315+a, gdbSNP:199507985
330+a, gdbSNP:200254850
342+a, cdbSNP:201165989
363+c, tdbSNP:387906698
364+a, c, gdbSNP:199769221
378+a, gdbSNP:199422123
381+c, tdbSNP:111033568
382..383+at, gcdbSNP:267606982
382+a, gdbSNP:111033565
383+c, tdbSNP:201487096
384+a, gdbSNP:144403091
390+a, gdbSNP:200976326
complement(405)-t, cdbSNP:11553845
406+c, tdbSNP:193922655
408+a, g, tdbSNP:141011596
410+c, tdbSNP:200699755
413+c, tdbSNP:199931737
415+c, gdbSNP:193922656
420+a, gdbSNP:199637670
427+c, tdbSNP:117497341
428+a, gdbSNP:369013081
429+a, gdbSNP:11553849
432+a, tdbSNP:397507440
434+c, tdbSNP:141847266
459..460+ct, gcdbSNP:386718744
461+c, g, tdbSNP:11553844
464+a, cdbSNP:372698855
470+c, tdbSNP:147765409
474+dbSNP:
474+c, gdbSNP:61735002
485+c, tdbSNP:146076691
486+a, gdbSNP:200890507
497+c, tdbSNP:200267714
complement(503)-g, adbSNP:6666
511+c, tdbSNP:202228418
525+a, gdbSNP:201550522
529+a, gdbSNP:200973660
complement(543)-g, adbSNP:11553847
551+a, gdbSNP:267601347
558+a, gdbSNP:376907511
559+a, gdbSNP:201719096
564+a, gdbSNP:200070487
complement(568)-g, adbSNP:11553848
578+c, tdbSNP:1804561
584+c, tdbSNP:377124851
585+g, tdbSNP:11553850
622+c, gdbSNP:199531292
623+c, tdbSNP:368414354
634+c, gdbSNP:150930992
638+c, tdbSNP:146995038
640+c, gdbSNP:189270875
642+c, gdbSNP:140793689
654+a, gdbSNP:200902389
659+a, cdbSNP:141697925
670+a, tdbSNP:199878511
671+c, tdbSNP:372703495
692+a, gdbSNP:375871958
722+c, tdbSNP:1042921
726+a, gdbSNP:150083974
728+a, cdbSNP:138362833
738+a, gdbSNP:141554682
complement(755)-g, adbSNP:6667
Gene SymbolPRSS1
Gene SynonymTRP1; TRY1; TRY4; TRYP1
Chromosome7
Locus Map7q34
Title The histopathology of PRSS1 hereditary pancreatitis .
Author Singhi AD, Pai RK, Kant JA, Bartholow TL, Zeh HJ, Lee KK, Wijkstrom M, Yadav D, Bottino R, Brand RE, Chennat JS, Lowe ME, Papachristou GI, Slivka A, Whitcomb DC and Humar A.
Journal Am. J. Surg. Pathol. 38 (3), 346-353 (2014)
Title Zymogen activation confers thermodynamic stability on a key peptide bond and protects human cationic trypsin from degradation .
Author Szabo A, Radisky ES and Sahin-Toth M.
Journal J. Biol. Chem. 289 (8), 4753-4761 (2014)
Title Autocrine extra-pancreatic trypsin 3 secretion promotes cell proliferation and survival in esophageal adenocarcinoma .
Author Han S, Lee CW, Trevino JG, Hughes SJ and Sarosi GA Jr.
Journal PLoS ONE 8 (10), E76667 (2013)
Title A conservative assessment of the major genetic causes of idiopathic chronic pancreatitis: data from a comprehensive analysis of PRSS1, SPINK1, CTRC and CFTR genes in 253 young French patients .
Author Masson E, Chen JM, Audrezet MP, Cooper DN and Ferec C.
Journal PLoS ONE 8 (8), E73522 (2013)
Title Pancreatitis Overview .
Author LaRusch,J., Solomon,S. and Whitcomb,D.C.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title PRSS1-Related Hereditary Pancreatitis .
Author Solomon,S., Whitcomb,D.C. and LaRusch,J.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Isolation of a cDNA encoding a human serum marker for acute pancreatitis. Identification of pancreas-specific protein as pancreatic procarboxypeptidase B .
Author Yamamoto KK, Pousette A, Chow P, Wilson H, el Shami S and French CK.
Journal J. Biol. Chem. 267 (4), 2575-2581 (1992)
Title Immunoreactive anionic and cationic trypsin in human serum .
Author Kimland M, Russick C, Marks WH and Borgstrom A.
Journal Clin. Chim. Acta 184 (1), 31-46 (1989)
Title The reactive site of human alpha 2-antiplasmin .
Author Shieh,B.H. and Travis,J.
Journal J. Biol. Chem. 262 (13), 6055-6059 (1987)
Title Cloning, characterization and nucleotide sequences of two cDNAs encoding human pancreatic trypsinogens .
Author Emi,M., Nakamura,Y., Ogawa,M., Yamamoto,T., Nishide,T., Mori,T. and Matsubara,K.
Journal Gene 41 (2-3), 305-310 (1986)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.