• THAT   AND
  • THAT   AND


Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_002769 Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA. Full Lenth $240.99
ORF Sequence $215.76


RefSeq Version NM_002769.4, 310923201
Length 831 bp
Structure linear
Update Date 01-MAY-2011
Organism Homo sapiens (human)
Definition Homo sapiens protease, serine, 1 (trypsin 1) (PRSS1), mRNA.
Product trypsin-1 preproprotein
Comment

Summary: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. [provided by RefSeq].

RefSeq NP_002760.1
CDS 18..761
Exon (1)1..57
Exon (2)1..57
Exon (3)58..217
Exon (4)218..471
Exon (5)472..608
Exon (6)609..817
Translation MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK NTIAANS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolPRSS1
Gene SynonymDKFZp779A0837; FLJ57296; MGC120175; MGC149362; TRP1; TRY1; TRY4; TRYP1
Chromosome7
Locus Map7q34
All Transcripts NM_002769
Title The prevalence of cationic trypsinogen (PRSS1) and serine protease inhibitor, Kazal type 1 (SPINK1) gene mutations in Polish patients with alcoholic and idiopathic chronic pancreatitis .
Author Gasiorowska,A., Talar-Wojnarowska,R., Czupryniak,L., Smolarz,B., Romanowicz-Makowska,H., Kulig,A. and Malecka-Panas,E.
Journal Dig. Dis. Sci. 56 (3), 894-901 (2011)
Title Genetic, epidemiological, and clinical aspects of hereditary pancreatitis: a population-based cohort study in Denmark .
Author Joergensen,M.T., Brusgaard,K., Cruger,D.G., Gerdes,A.M. and Schaffalitzky de Muckadell,O.B.
Journal Am. J. Gastroenterol. 105 (8), 1876-1883 (2010)
Title Uncertainties in the classification of human cationic trypsinogen (PRSS1) variants as hereditary pancreatitis-associated mutations .
Author Szmola,R. and Sahin-Toth,M.
Journal J. Med. Genet. 47 (5), 348-350 (2010)
Title New PRSS1 and common CFTR mutations in a child with acute recurrent pancreatitis, could be considered an 'Hereditary' form of pancreatitis ? .
Author Corleto,V.D., Gambardella,S., Gullotta,F., D'Apice,M.R., Piciucchi,M., Galli,E., Lucidi,V., Novelli,G. and Delle Fave,G.
Journal BMC Gastroenterol 10, 119 (2010)
Title Pre-diagnostic levels of anionic trypsinogen, cationic trypsinogen, and pancreatic secretory trypsin inhibitor in relation to pancreatic cancer risk .
Author Johansen,D., Manjer,J., Regner,S. and Lindkvist,B.
Journal Pancreatology 10 (2-3), 229-237 (2010)
Title Isolation of a cDNA encoding a human serum marker for acute pancreatitis. Identification of pancreas-specific protein as pancreatic procarboxypeptidase B .
Author Yamamoto,K.K., Pousette,A., Chow,P., Wilson,H., el Shami,S. and French,C.K.
Journal J. Biol. Chem. 267 (4), 2575-2581 (1992)
Title Immunoreactive anionic and cationic trypsin in human serum .
Author Kimland,M., Russick,C., Marks,W.H. and Borgstrom,A.
Journal Clin. Chim. Acta 184 (1), 31-46 (1989)
Title The reactive site of human alpha 2-antiplasmin .
Author Shieh,B.H. and Travis,J.
Journal J. Biol. Chem. 262 (13), 6055-6059 (1987)
Title Cloning, characterization and nucleotide sequences of two cDNAs encoding human pancreatic trypsinogens .
Author Emi,M., Nakamura,Y., Ogawa,M., Yamamoto,T., Nishide,T., Mori,T. and Matsubara,K.
Journal Gene 41 (2-3), 305-310 (1986)
Title Chromosomal assignments of human genes for serine proteases trypsin, chymotrypsin B, and elastase .
Author Honey,N.K., Sakaguchi,A.Y., Quinto,C., MacDonald,R.J., Bell,G.I., Craik,C., Rutter,W.J. and Naylor,S.L.
Journal Somat. Cell Mol. Genet. 10 (4), 369-376 (1984)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878