• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens proteinase 3 (PRTN3), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25395 Homo sapiens proteinase 3 (PRTN3), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu25395C Homo sapiens proteinase 3 (PRTN3), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_002777.3, 71361687
Length 771 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens proteinase 3 (PRTN3), mRNA.
Product myeloblastin precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from M75154.1, BC096185.3 and AC004799.2. On Jul 28, 2005 this sequence version replaced gi:7382457.

RefSeq NP_002768.3
CDS 25..795
Misc Feature(1)103..753
Misc Feature(2)106..762
Misc Feature(3)106..108
Misc Feature(4)order(235..237,376..378,631..633)
Misc Feature(5)order(613..615,676..678,682..684)
Exon (1)1..85
Gene:PRTN3
Gene Synonym:ACPA; AGP7; C-ANCA; CANCA; MBN; MBT; NP-4; NP4; P29; PR-3; PR3
Exon (2)86..251
Gene:PRTN3
Gene Synonym:ACPA; AGP7; C-ANCA; CANCA; MBN; MBT; NP-4; NP4; P29; PR-3; PR3
Exon (3)252..393
Gene:PRTN3
Gene Synonym:ACPA; AGP7; C-ANCA; CANCA; MBN; MBT; NP-4; NP4; P29; PR-3; PR3
Exon (4)394..624
Gene:PRTN3
Gene Synonym:ACPA; AGP7; C-ANCA; CANCA; MBN; MBT; NP-4; NP4; P29; PR-3; PR3
Exon (5)625..1001
Gene:PRTN3
Gene Synonym:ACPA; AGP7; C-ANCA; CANCA; MBN; MBT; NP-4; NP4; P29; PR-3; PR3
Translation MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTL IHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVL LIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTF FCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYV DWIRSTLRRVEAKGRP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Gene SymbolPRTN3
Gene SynonymACPA; AGP7; C-ANCA; CANCA; MBN; MBT; NP-4; NP4; P29; PR-3; PR3
Chromosome19
Locus Map19p13.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002777 Homo sapiens proteinase 3 (PRTN3), mRNA. In-stock $99.00 5-7
Title Hypertrophic pachymeningitis: significance of myeloperoxidase anti-neutrophil cytoplasmic antibody .
Author Yokoseki A, Saji E, Arakawa M, Kosaka T, Hokari M, Toyoshima Y, Okamoto K, Takeda S, Sanpei K, Kikuchi H, Hirohata S, Akazawa K, Kakita A, Takahashi H, Nishizawa M and Kawachi I.
Journal Brain 137 (PT 2), 520-536 (2014)
Title Development and validation of a lateral flow assay (LFA) for the determination of IgG-antibodies to Pr3 (cANCA) and MPO (pANCA) .
Author Offermann N, Conrad K, Fritzler MJ and Fooke Achterrath M.
Journal J. Immunol. Methods 403 (1-2), 1-6 (2014)
Title Neutrophil elastase and proteinase-3 trigger G protein-biased signaling through proteinase-activated receptor-1 (PAR1) .
Author Mihara K, Ramachandran R, Renaux B, Saifeddine M and Hollenberg MD.
Journal J. Biol. Chem. 288 (46), 32979-32990 (2013)
Title Antineutrophil cytoplasmic antibodies in bile are associated with disease activity in primary sclerosing cholangitis .
Author Lenzen H, Weismuller TJ, Negm AA, Wlecke J, Loges S, Strassburg CP, Manns MP and Lankisch TO.
Journal Scand. J. Gastroenterol. 48 (10), 1205-1212 (2013)
Title Changes in proteinase 3 anti-neutrophil cytoplasm autoantibody levels in early systemic granulomatosis with polyangiitis (Wegener's) may reflect treatment rather than disease activity .
Author Rasmussen N, Salmela A, Ekstrand A, de Groot K, Gregorini G, Cohen Tervaert JW, Gross WL, Wiik A and Jayne DR.
Journal Clin. Exp. Rheumatol. 31 (1 SUPPL 75), S38-S44 (2013)
Title Structure, chromosomal assignment, and expression of the gene for proteinase-3. The Wegener's granulomatosis autoantigen .
Author Sturrock AB, Franklin KF, Rao G, Marshall BC, Rebentisch MB, Lemons
Journal J. Biol. Chem. 267 (29), 21193-21199 (1992)
Title Three human elastase-like genes coordinately expressed in the myelomonocyte lineage are organized as a single genetic locus on 19pter .
Author Zimmer M, Medcalf RL, Fink TM, Mattmann C, Lichter P and Jenne DE.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (17), 8215-8219 (1992)
Title Wegener autoantigen and myeloblastin are encoded by a single mRNA .
Author Labbaye C, Musette P and Cayre YE.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (20), 9253-9256 (1991)
Title Wegener's autoantigen and leukemia .
Author Musette,P., Labbaye,C., Dorner,M.H., Cayre,Y.E., Casanova,J.L. and Kourilsky,P.
Journal Blood 77 (6), 1398-1399 (1991)
Title Anti-neutrophil cytoplasm antibodies in Wegener's granulomatosis recognize an elastinolytic enzyme .
Author Ludemann J, Utecht B and Gross WL.
Journal J. Exp. Med. 171 (1), 357-362 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.