• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens parvalbumin (PVALB), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002854 Homo sapiens parvalbumin (PVALB), mRNA. GenEZ ORF Cloning In-stock $248.00 $199.00 10

*Business Day

Related Services

RefSeq Version NM_002854.2, 55925656
Length 586 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens parvalbumin (PVALB), mRNA.
Product parvalbumin alpha
Comment

Summary: The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation. [provided by RefSeq, Jul 2008].

RefSeq NP_002845.1
CDS 51..383
Misc Feature(1)54..56
Misc Feature(2)54..56
Misc Feature(3)177..257
Exon (1)44..111
Gene:PVALB
Gene Synonym:D22S749
Exon (2)112..244
Gene:PVALB
Gene Synonym:D22S749
Exon (3)245..354
Gene:PVALB
Gene Synonym:D22S749
Exon (4)355..572
Gene:PVALB
Gene Synonym:D22S749
Translation MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIE EDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(36)-dbSNP:
complement(36)-g, adbSNP:142112924
complement(104)-g, adbSNP:142013245
complement(172)-g, adbSNP:74804322
complement(181)-g, adbSNP:113640345
complement(188)-t, cdbSNP:143039041
complement(202)-c, adbSNP:149050098
complement(228)-t, cdbSNP:137928260
complement(236)-g, adbSNP:201360453
complement(243)-t, cdbSNP:147596087
complement(282)-dbSNP:
complement(282)-g, adbSNP:35095499
complement(307)-g, adbSNP:146738911
complement(319)-t, cdbSNP:144686174
complement(329)-t, adbSNP:1131432
complement(353)-g, adbSNP:200610184
complement(412)-g, cdbSNP:12483924
complement(437)-c, adbSNP:9607383
complement(438)-c, adbSNP:181855770
complement(446)-g, adbSNP:3484
complement(501)-g, adbSNP:56010443
Gene SymbolPVALB
Gene SynonymD22S749
Chromosome22
Locus Map22q13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002854 Homo sapiens parvalbumin (PVALB), mRNA. In-stock $248.00 $199.00 10
Title A genome-wide association study of female sexual dysfunction .
Author Burri,A., Hysi,P., Clop,A., Rahman,Q. and Spector,T.D.
Journal PLoS ONE 7 (4), E35041 (2012)
Title Distribution of GABAergic interneurons and dopaminergic cells in the functional territories of the human striatum .
Author Bernacer,J., Prensa,L. and Gimenez-Amaya,J.M.
Journal PLoS ONE 7 (1), E30504 (2012)
Title PVALB, a new Hurthle adenoma diagnostic marker identified through gene expression .
Author Cerutti,J.M., Oler,G., Delcelo,R., Gerardt,R., Michaluart,P. Jr., de Souza,S.J., Galante,P.A., Huang,P. and Riggins,G.J.
Journal J. Clin. Endocrinol. Metab. 96 (1), E151-E160 (2011)
Title Parvalbumin: Targeting calcium handling in cardiac diastolic dysfunction .
Author Wang,W., Martindale,J. and Metzger,J.M.
Journal Gen. Physiol. Biophys. 28 (SPEC NO FOCUS), F3-F6 (2009)
Title Evaluating PVALB as a candidate gene for SLC12A3-negative cases of Gitelman's syndrome .
Author Riveira-Munoz,E., Devuyst,O., Belge,H., Jeck,N., Strompf,L., Vargas-Poussou,R., Jeunemaitre,X., Blanchard,A., Knoers,N.V., Konrad,M. and Dahan,K.
Journal Nephrol. Dial. Transplant. 23 (10), 3120-3125 (2008)
Title Distribution of calretinin, calbindin D28k, and parvalbumin in subcellular fractions of rat cerebellum: effects of calcium .
Author Winsky,L. and Kuznicki,J.
Journal J. Neurochem. 65 (1), 381-388 (1995)
Title Human alpha and beta parvalbumins. Structure and tissue-specific expression .
Author Fohr,U.G., Weber,B.R., Muntener,M., Staudenmann,W., Hughes,G.J., Frutiger,S., Banville,D., Schafer,B.W. and Heizmann,C.W.
Journal Eur. J. Biochem. 215 (3), 719-727 (1993)
Title An STS in the human parvalbumin gene (PVALB) .
Author Ritzler,J.M. and Berchtold,M.W.
Journal Nucleic Acids Res. 20 (6), 1428 (1992)
Title The genes for the highly homologous Ca(2+)-binding proteins oncomodulin and parvalbumin are not linked in the human genome .
Author Ritzler,J.M., Sawhney,R., Geurts van Kessel,A.H., Grzeschik,K.H., Schinzel,A. and Berchtold,M.W.
Journal Genomics 12 (3), 567-572 (1992)
Title Parvalbumin genes from human and rat are identical in intron/exon organization and contain highly homologous regulatory elements and coding sequences .
Author Berchtold,M.W.
Journal J. Mol. Biol. 210 (3), 417-427 (1989)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.