• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens parvalbumin (PVALB), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002854 Homo sapiens parvalbumin (PVALB), mRNA. GenEZ ORF Cloning In-stock $248.00 $199.00 10

*Business Day

Related Services

RefSeq Version NM_002854.2, 55925656
Length 586 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens parvalbumin (PVALB), mRNA.
Product parvalbumin alpha
Comment

Summary: The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation. [provided by RefSeq, Jul 2008].

RefSeq NP_002845.1
CDS 51..383
Misc Feature(1)54..56
Misc Feature(2)54..56
Misc Feature(3)177..374
Misc Feature(4)198..371
Misc Feature(5)order(204..206,210..212,216..218,237..239,321..323,
Exon (1)44..111
Gene:PVALB
Gene Synonym:D22S749
Exon (2)112..244
Gene:PVALB
Gene Synonym:D22S749
Exon (3)245..354
Gene:PVALB
Gene Synonym:D22S749
Exon (4)355..572
Gene:PVALB
Gene Synonym:D22S749
Translation MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIE EDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(36)-dbSNP:
complement(36)-g, adbSNP:142112924
complement(51)-t, adbSNP:374691096
complement(56)-c, adbSNP:370446334
complement(99)-t, cdbSNP:376891246
complement(104)-g, adbSNP:142013245
complement(116)-dbSNP:
complement(116)-g, adbSNP:373272423
complement(125)-t, gdbSNP:369091292
complement(152)-g, adbSNP:377039488
complement(172)-g, adbSNP:74804322
complement(173)-t, cdbSNP:374970603
complement(181)-g, adbSNP:113640345
complement(188)-t, cdbSNP:143039041
complement(202)-c, adbSNP:149050098
complement(210)-t, cdbSNP:369226680
complement(228)-t, cdbSNP:137928260
complement(236)-g, adbSNP:201360453
complement(243)-t, cdbSNP:147596087
complement(251)-dbSNP:
complement(251)-g, adbSNP:370605791
complement(259)-g, cdbSNP:377350741
complement(272)-g, adbSNP:373803988
complement(282)-g, adbSNP:35095499
complement(289)-g, adbSNP:371491934
complement(301)-t, gdbSNP:376442328
complement(307)-g, adbSNP:146738911
complement(319)-t, cdbSNP:144686174
329+a, tdbSNP:1131432
complement(353)-g, adbSNP:200610184
complement(412)-g, cdbSNP:12483924
complement(436)-g, adbSNP:374659208
complement(437)-c, adbSNP:9607383
complement(438)-c, adbSNP:181855770
complement(446)-g, adbSNP:3484
complement(501)-g, adbSNP:56010443
Gene SymbolPVALB
Gene SynonymD22S749
Chromosome22
Locus Map22q13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002854 Homo sapiens parvalbumin (PVALB), mRNA. In-stock $248.00 $199.00 10
XM_006724285 PREDICTED: Homo sapiens parvalbumin (PVALB), transcript variant X1, mRNA. On-demand $299.00 14
XM_006725404 PREDICTED: Homo sapiens parvalbumin (PVALB), transcript variant X1, mRNA. On-demand $299.00 14
Title Decreased parvalbumin mRNA expression in dorsolateral prefrontal cortex in Parkinson's disease .
Author Lanoue AC, Blatt GJ and Soghomonian JJ.
Journal Brain Res. 1531, 37-47 (2013)
Title Loss of calretinin- and parvalbumin-immunoreactive axons in anterolateral columns beyond the corticospinal tracts of amyotrophic lateral sclerosis spinal cords .
Author Hayashi S, Amari M and Okamoto K.
Journal J. Neurol. Sci. 331 (1-2), 61-66 (2013)
Title Contrast dependence and differential contributions from somatostatin- and parvalbumin-expressing neurons to spatial integration in mouse V1 .
Author Nienborg H, Hasenstaub A, Nauhaus I, Taniguchi H, Huang ZJ and Callaway EM.
Journal J. Neurosci. 33 (27), 11145-11154 (2013)
Title Genome-wide association studies of pit-and-fissure- and smooth-surface caries in permanent dentition .
Author Zeng Z, Shaffer JR, Wang X, Feingold E, Weeks DE, Lee M, Cuenco KT, Wendell SK, Weyant RJ, Crout R, McNeil DW and Marazita ML.
Journal J. Dent. Res. 92 (5), 432-437 (2013)
Title Distribution and intrinsic membrane properties of basal forebrain GABAergic and parvalbumin neurons in the mouse .
Author McKenna JT, Yang C, Franciosi S, Winston S, Abarr KK, Rigby MS, Yanagawa Y, McCarley RW and Brown RE.
Journal J. Comp. Neurol. 521 (6), 1225-1250 (2013)
Title Distribution of calretinin, calbindin D28k, and parvalbumin in subcellular fractions of rat cerebellum: effects of calcium .
Author Winsky L and Kuznicki J.
Journal J. Neurochem. 65 (1), 381-388 (1995)
Title Human alpha and beta parvalbumins. Structure and tissue-specific expression .
Author Fohr UG, Weber BR, Muntener M, Staudenmann W, Hughes GJ, Frutiger S, Banville D, Schafer BW and Heizmann CW.
Journal Eur. J. Biochem. 215 (3), 719-727 (1993)
Title An STS in the human parvalbumin gene (PVALB) .
Author Ritzler JM and Berchtold MW.
Journal Nucleic Acids Res. 20 (6), 1428 (1992)
Title The genes for the highly homologous Ca(2+)-binding proteins oncomodulin and parvalbumin are not linked in the human genome .
Author Ritzler JM, Sawhney R, Geurts van Kessel AH, Grzeschik KH, Schinzel
Journal Genomics 12 (3), 567-572 (1992)
Title Parvalbumin genes from human and rat are identical in intron/exon organization and contain highly homologous regulatory elements and coding sequences .
Author Berchtold MW.
Journal J. Mol. Biol. 210 (3), 417-427 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.