• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens RAD51 homolog (S. cerevisiae) (RAD51), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002875 Homo sapiens RAD51 homolog (S. cerevisiae) (RAD51), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_002875.4, 256017139
Length 2299 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens RAD51 homolog (S. cerevisiae) (RAD51), transcript variant 1, mRNA.
Product DNA repair protein RAD51 homolog 1 isoform 1
Comment

Summary: The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009].


Transcript Variant: This variant (1) uses an alternate exon in the 5' coding region, compared to variant 2. The resulting isoform (1) contains a distinct segment near the N-terminus, compared to isoform 2.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002866.2
CDS 300..1319
Misc Feature(1)249..251
Misc Feature(2)372..1316
Misc Feature(3)372..1316
Misc Feature(4)396..533
Misc Feature(5)459..461
Misc Feature(6)459..461
Misc Feature(7)603..1304
Misc Feature(8)678..701
Misc Feature(9)order(684..686,696..701,774..776,780..782,786..788,
Misc Feature(10)order(771..773,777..779,801..803,810..812,855..857,
Misc Feature(11)849..1070
Misc Feature(12)858..860
Misc Feature(13)858..860
Misc Feature(14)951..965
Misc Feature(15)1119..1121
Misc Feature(16)1119..1121
Misc Feature(17)1224..1226
Misc Feature(18)1224..1226
Misc Feature(19)1242..1244
Exon (1)1..297
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (2)298..386
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (3)387..524
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (4)525..642
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (5)643..734
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (6)735..829
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (7)830..943
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (8)944..1073
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (9)1074..1195
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (10)1196..2299
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Translation MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
71+dbSNP:
71+, cdbSNP:141666931
92+c, gdbSNP:35722406
93+c, tdbSNP:34445444
132+a, gdbSNP:34504099
149+a, gdbSNP:138222339
202+c, gdbSNP:1801320
228+c, gdbSNP:34678507
229+c, gdbSNP:35798097
239+c, g, tdbSNP:1801321
298..299+dbSNP:
298..299+, adbSNP:201165907
299..300+, adbSNP:55714242
299+a, cdbSNP:150213086
404+dbSNP:
404+c, tdbSNP:145745388
407+c, tdbSNP:201437876
443+c, tdbSNP:140524566
454+g, tdbSNP:80233386
463+c, tdbSNP:145617142
465+c, tdbSNP:45623838
504+c, gdbSNP:143055953
535+dbSNP:
535+c, tdbSNP:146489542
624+c, gdbSNP:7174493
663+dbSNP:
663+a, gdbSNP:143362775
715+c, tdbSNP:148345609
722+c, tdbSNP:200801013
748+dbSNP:
748+a, gdbSNP:121917739
804+a, gdbSNP:77029343
839+dbSNP:
839+c, tdbSNP:150540342
878+a, gdbSNP:11544204
927+a, cdbSNP:76693779
944+dbSNP:
944+a, gdbSNP:140361078
970+c, gdbSNP:142701178
974+c, tdbSNP:147352002
977+c, tdbSNP:1804269
1017+g, tdbSNP:11544205
1019+c, gdbSNP:188331342
1059+a, cdbSNP:199925463
1072+a, cdbSNP:191297852
1149+dbSNP:
1149+, adbSNP:34091239
1199+dbSNP:
1199+a, gdbSNP:201045587
1236+a, cdbSNP:1056742
1244+c, tdbSNP:139810756
1283+a, cdbSNP:149952826
1310+c, tdbSNP:202116013
1368+c, gdbSNP:201490271
1697+a, gdbSNP:183266329
1753+c, gdbSNP:55814668
1821+g, tdbSNP:12593359
1853+a, gdbSNP:146115814
1912+a, gdbSNP:138965160
1958+a, gdbSNP:45511893
1974+c, tdbSNP:187525601
2012+a, gdbSNP:192004520
2013+a, cdbSNP:45527134
2037+a, gdbSNP:7180135
2063+a, cdbSNP:150778189
2135+a, gdbSNP:56390641
2232+a, cdbSNP:45549040
2246+c, tdbSNP:11855560
2248+a, c, g, tdbSNP:45507396
2270+c, gdbSNP:45577634
2282+a, gdbSNP:149380275
2295+g, tdbSNP:144755650
Gene SymbolRAD51
Gene SynonymBRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Chromosome15
Locus Map15q15.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001164269 Homo sapiens RAD51 homolog (S. cerevisiae) (RAD51), transcript variant 4, mRNA. On-demand $549.00 14
NM_001164270 Homo sapiens RAD51 homolog (S. cerevisiae) (RAD51), transcript variant 3, mRNA. On-demand $449.00 14
NM_002875 Homo sapiens RAD51 homolog (S. cerevisiae) (RAD51), transcript variant 1, mRNA. On-demand $549.00 14
NM_133487 Homo sapiens RAD51 homolog (S. cerevisiae) (RAD51), transcript variant 2, mRNA. On-demand $549.00 14
Title Rad51 paralog complexes BCDX2 and CX3 act at different stages in the BRCA1-BRCA2-dependent homologous recombination pathway .
Author Chun,J., Buechelmaier,E.S. and Powell,S.N.
Journal Mol. Cell. Biol. 33 (2), 387-395 (2013)
Title The chromatin remodeler p400 ATPase facilitates Rad51-mediated repair of DNA double-strand breaks .
Author Courilleau,C., Chailleux,C., Jauneau,A., Grimal,F., Briois,S., Boutet-Robinet,E., Boudsocq,F., Trouche,D. and Canitrot,Y.
Journal J. Cell Biol. 199 (7), 1067-1081 (2012)
Title RAD51 gene polymorphisms and sporadic colorectal cancer risk in Poland .
Author Romanowicz-Makowska,H., Samulak,D., Michalska,M., Sporny,S., Langner,E., Dziki,A., Sychowski,R. and Smolarz,B.
Journal Pol J Pathol 63 (3), 193-198 (2012)
Title Lack of association between the 135G/C RAD51 gene polymorphism and the risk of colorectal cancer among Polish population .
Author Mucha,B., Przybylowska-Sygut,K., Dziki,L., Dziki,A., Sygut,A. and Majsterek,I.
Journal Pol Przegl Chir 84 (7), 358-362 (2012)
Title A single nucleotide polymorphism in the 5' untranslated region of RAD51 and ovarian cancer risk in Polish women .
Author Romanowicz-Makowska,H., Smolarz,B., Samulak,D., Michalska,M., Lewy,J., Burzynski,M. and Kokolaszwili,G.
Journal Eur. J. Gynaecol. Oncol. 33 (4), 406-410 (2012)
Title Mammalian ubiquitin-conjugating enzyme Ubc9 interacts with Rad51 recombination protein and localizes in synaptonemal complexes .
Author Kovalenko,O.V., Plug,A.W., Haaf,T., Gonda,D.K., Ashley,T., Ward,D.C., Radding,C.M. and Golub,E.I.
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (7), 2958-2963 (1996)
Title Purification and characterization of the human Rad51 protein, an analogue of E. coli RecA .
Author Benson,F.E., Stasiak,A. and West,S.C.
Journal EMBO J. 13 (23), 5764-5771 (1994)
Title Chromosome mapping of the human (RECA) and mouse (Reca) homologs of the yeast RAD51 and Escherichia coli recA genes to human (15q15.1) and mouse (2F1) chromosomes by direct R-banding fluorescence in situ hybridization .
Author Takahashi,E., Matsuda,Y., Hori,T., Yasuda,N., Tsuji,S., Mori,M., Yoshimura,Y., Yamamoto,A., Morita,T. and Matsushiro,A.
Journal Genomics 19 (2), 376-378 (1994)
Title Cloning of human, mouse and fission yeast recombination genes homologous to RAD51 and recA .
Author Shinohara,A., Ogawa,H., Matsuda,Y., Ushio,N., Ikeo,K. and Ogawa,T.
Journal Nat. Genet. 4 (3), 239-243 (1993)
Title Cloning and sequence of the human RecA-like gene cDNA .
Author Yoshimura,Y., Morita,T., Yamamoto,A. and Matsushiro,A.
Journal Nucleic Acids Res. 21 (7), 1665 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.