• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens RAD51 recombinase (RAD51), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu21153 Homo sapiens RAD51 recombinase (RAD51), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu21153C Homo sapiens RAD51 recombinase (RAD51), transcript variant 1, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002875.4, 256017139
Length 1020 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens RAD51 recombinase (RAD51), transcript variant 1, mRNA.
Product DNA repair protein RAD51 homolog 1 isoform 1
Comment

Summary: The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009].


Transcript Variant: This variant (1) uses an alternate exon in the 5' coding region, compared to variant 2. The resulting isoform (1) contains a distinct segment near the N-terminus, compared to isoform 2.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002866.2
CDS 300..1319
Misc Feature(1)249..251
Misc Feature(2)303..305
Misc Feature(3)303..305
Misc Feature(4)372..1316
Misc Feature(5)393..539
Misc Feature(6)459..461
Misc Feature(7)459..461
Misc Feature(8)603..1304
Misc Feature(9)678..701
Misc Feature(10)order(684..686,696..701,774..776,780..782,786..788,
Misc Feature(11)order(771..773,777..779,801..803,810..812,855..857,
Misc Feature(12)849..1070
Misc Feature(13)858..860
Misc Feature(14)858..860
Misc Feature(15)951..965
Misc Feature(16)1119..1121
Misc Feature(17)1119..1121
Misc Feature(18)1224..1226
Misc Feature(19)1224..1226
Misc Feature(20)1242..1244
Exon (1)1..297
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (2)298..386
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (3)387..524
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (4)525..642
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (5)643..734
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (6)735..829
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (7)830..943
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (8)944..1073
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (9)1074..1195
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Exon (10)1196..2299
Gene:RAD51
Gene Synonym:BRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Translation MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
71+dbSNP:
71+, cdbSNP:141666931
92+c, gdbSNP:35722406
93+c, tdbSNP:34445444
132+a, gdbSNP:34504099
149+a, gdbSNP:138222339
202+c, gdbSNP:1801320
228..229+c, gdbSNP:34678507
239+c, g, tdbSNP:1801321
298..299+dbSNP:
298..299+, adbSNP:201165907
299+a, cdbSNP:150213086
300..301+, adbSNP:55714242
307+c, tdbSNP:374776986
403+dbSNP:
403+a, cdbSNP:377571591
404+c, tdbSNP:145745388
407+c, tdbSNP:201437876
443+c, tdbSNP:140524566
454+g, tdbSNP:80233386
463+c, tdbSNP:145617142
465+c, tdbSNP:45623838
504+c, gdbSNP:143055953
535+dbSNP:
535+c, tdbSNP:146489542
579+c, gdbSNP:376382204
624+c, gdbSNP:7174493
663+dbSNP:
663+a, gdbSNP:143362775
715+c, tdbSNP:148345609
722+c, tdbSNP:200801013
748+dbSNP:
748+a, gdbSNP:121917739
803+a, gdbSNP:377264704
804+a, gdbSNP:77029343
839+dbSNP:
839+c, tdbSNP:150540342
878+a, gdbSNP:11544204
927+a, cdbSNP:76693779
944+dbSNP:
944+a, gdbSNP:140361078
970+c, gdbSNP:142701178
974+c, tdbSNP:147352002
977+c, tdbSNP:1804269
1017+g, tdbSNP:11544205
1019+c, gdbSNP:188331342
1057+g, tdbSNP:376436790
1059+a, c, tdbSNP:199925463
1060+a, gdbSNP:371150683
1065+a, gdbSNP:374507935
1072+a, cdbSNP:191297852
1149+dbSNP:
1149+, adbSNP:34091239
1199+dbSNP:
1199+a, gdbSNP:201045587
1236+a, cdbSNP:1056742
1244+c, tdbSNP:139810756
1277+a, gdbSNP:374679595
1281+g, tdbSNP:367685211
1310+c, tdbSNP:202116013
1368+c, gdbSNP:201490271
1697+a, gdbSNP:183266329
1744+c, gdbSNP:369695117
1753+c, gdbSNP:55814668
1821+g, tdbSNP:12593359
complement(1853)-g, adbSNP:146115814
1912+a, gdbSNP:138965160
1958+a, gdbSNP:45511893
1974+c, tdbSNP:187525601
2012+a, gdbSNP:192004520
2013+a, cdbSNP:45527134
2037+a, gdbSNP:7180135
2063+a, cdbSNP:150778189
2135+a, gdbSNP:56390641
2232+a, cdbSNP:45549040
2246+c, tdbSNP:11855560
2248+a, c, g, tdbSNP:45507396
2270+c, gdbSNP:45577634
2282+a, gdbSNP:149380275
complement(2295)-t, gdbSNP:144755650
Gene SymbolRAD51
Gene SynonymBRCC5; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA
Chromosome15
Locus Map15q15.1
Title Association between RAD51 gene polymorphism (-135G/C) and susceptibility of myelodysplastic syndrome and acute leukemia: evidence based on a meta-analysis .
Author He YZ, Hu X, Chi XS, Zhang YC, Deng XB, Wei MT, Wang ZQ and Zhou YH.
Journal Tumour Biol. 35 (1), 615-621 (2014)
Title FBH1 helicase disrupts RAD51 filaments in vitro and modulates homologous recombination in mammalian cells .
Author Simandlova J, Zagelbaum J, Payne MJ, Chu WK, Shevelev I, Hanada K, Chatterjee S, Reid DA, Liu Y, Janscak P, Rothenberg E and Hickson ID.
Journal J. Biol. Chem. 288 (47), 34168-34180 (2013)
Title RAD51 deficiency disrupts the corticospinal lateralization of motor control .
Author Gallea C, Popa T, Hubsch C, Valabregue R, Brochard V, Kundu P, Schmitt B, Bardinet E, Bertasi E, Flamand-Roze C, Alexandre N, Delmaire C, Meneret A, Depienne C, Poupon C, Hertz-Pannier L, Cincotta M, Vidailhet M, Lehericy S, Meunier S and Roze E.
Journal Brain 136 (PT 11), 3333-3346 (2013)
Title XRCC3 and RAD51 expression are associated with clinical factors in breast cancer .
Author Hu J, Wang N and Wang YJ.
Journal PLoS ONE 8 (8), E72104 (2013)
Title Human DNA helicase HELQ participates in DNA interstrand crosslink tolerance with ATR and RAD51 paralogs .
Author Takata K, Reh S, Tomida J, Person MD and Wood RD.
Journal Nat Commun 4, 2338 (2013)
Title Mammalian ubiquitin-conjugating enzyme Ubc9 interacts with Rad51 recombination protein and localizes in synaptonemal complexes .
Author Kovalenko OV, Plug AW, Haaf T, Gonda DK, Ashley T, Ward DC, Radding
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (7), 2958-2963 (1996)
Title Purification and characterization of the human Rad51 protein, an analogue of E. coli RecA .
Author Benson FE, Stasiak A and West SC.
Journal EMBO J. 13 (23), 5764-5771 (1994)
Title Chromosome mapping of the human (RECA) and mouse (Reca) homologs of the yeast RAD51 and Escherichia coli recA genes to human (15q15.1) and mouse (2F1) chromosomes by direct R-banding fluorescence in situ hybridization .
Author Takahashi E, Matsuda Y, Hori T, Yasuda N, Tsuji S, Mori M, Yoshimura Y, Yamamoto A, Morita T and Matsushiro A.
Journal Genomics 19 (2), 376-378 (1994)
Title Cloning of human, mouse and fission yeast recombination genes homologous to RAD51 and recA .
Author Shinohara A, Ogawa H, Matsuda Y, Ushio N, Ikeo K and Ogawa T.
Journal Nat. Genet. 4 (3), 239-243 (1993)
Title Cloning and sequence of the human RecA-like gene cDNA .
Author Yoshimura Y, Morita T, Yamamoto A and Matsushiro A.
Journal Nucleic Acids Res. 21 (7), 1665 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.