• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA.


RefSeq Accession Definition Services Price Order
NM_002982 Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002982.3, 56119169
Length 760 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA.
Product C-C motif chemokine 2
Comment

Summary: This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes and basophils but not for neutrophils or eosinophils. It has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis and atherosclerosis. It binds to chemokine receptors CCR2 and CCR4. [provided by RefSeq, Jul 2008].

RefSeq NP_002973.1
CDS 74..373
Misc Feature(1)143..145
Misc Feature(2)143..145
Misc Feature(3)152..154
Misc Feature(4)152..154
Misc Feature(5)152..154
Misc Feature(6)164..166
Misc Feature(7)173..346
Misc Feature(8)order(173..187,191..214,245..250,314..346)
Misc Feature(9)order(179..181,185..187,224..226,230..232,248..250,
Misc Feature(10)order(179..181,185..187,239..241,245..250,266..268,
Misc Feature(11)order(179..181,266..268,293..295)
Misc Feature(12)order(179..187,191..214)
Misc Feature(13)179..181
Misc Feature(14)order(185..187,224..226,230..232,263..265,269..271,
Misc Feature(15)order(191..199,206..214,281..283,287..289)
Misc Feature(16)194..196
Misc Feature(17)197..199
Misc Feature(18)212..214
Misc Feature(19)order(230..232,254..256,308..310,314..316,323..328,
Misc Feature(20)245..250
Misc Feature(21)245..247
Misc Feature(22)254..256
Misc Feature(23)order(275..277,281..283)
Misc Feature(24)287..289
Misc Feature(25)314..316
Misc Feature(26)338..340
Exon (1)1..149
Gene:CCL2
Gene Synonym:GDCF-2; HC11; HSMCR30; MCAF; MCP-1; MCP1; SCYA2; SMC-CF
Exon (2)150..267
Gene:CCL2
Gene Synonym:GDCF-2; HC11; HSMCR30; MCAF; MCP-1; MCP1; SCYA2; SMC-CF
Exon (3)268..749
Gene:CCL2
Gene Synonym:GDCF-2; HC11; HSMCR30; MCAF; MCP-1; MCP1; SCYA2; SMC-CF
Translation MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
56+c, tdbSNP:141271352
110+a, gdbSNP:144450837
155+dbSNP:
155+a, gdbSNP:146604396
178+c, tdbSNP:4586
195+a, gdbSNP:145056785
217+c, tdbSNP:138768575
219+c, tdbSNP:148937652
238+c, tdbSNP:143644230
278+dbSNP:
278+a, gdbSNP:148285031
284+a, gdbSNP:190996557
363+c, tdbSNP:199565451
415+g, tdbSNP:181021073
438+c, tdbSNP:13900
545+g, tdbSNP:186178409
597+a, cdbSNP:191032356
598+a, gdbSNP:2215182
655+a, tdbSNP:75284178
657+a, tdbSNP:75433364
657+, ttdbSNP:71804933
Gene SymbolCCL2
Gene SynonymGDCF-2; HC11; HSMCR30; MCAF; MCP-1; MCP1; SCYA2; SMC-CF
Chromosome17
Locus Map17q11.2-q12
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002982 Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA. Full Length $220.40
ORF Sequence $159.00
Title Increased urinary CCL2: Cr ratio at 6 months is associated with late renal allograft loss .
Author Ho,J., Wiebe,C., Rush,D.N., Rigatto,C., Storsley,L., Karpinski,M., Gao,A., Gibson,I.W. and Nickerson,P.W.
Journal Transplantation 95 (4), 595-602 (2013)
Title The monocyte chemoattractant protein-1 (MCP-1)/CCR2 system is involved in peritoneal dialysis-related epithelial-mesenchymal transition of peritoneal mesothelial cells .
Author Lee,S.H., Kang,H.Y., Kim,K.S., Nam,B.Y., Paeng,J., Kim,S., Li,J.J., Park,J.T., Kim,D.K., Han,S.H., Yoo,T.H. and Kang,S.W.
Journal Lab. Invest. 92 (12), 1698-1711 (2012)
Title Plasma monocyte chemotactic protein-1 levels at 24 hours are a biomarker of primary graft dysfunction after lung transplantation .
Author Shah,R.J., Diamond,J.M., Lederer,D.J., Arcasoy,S.M., Cantu,E.M., Demissie,E.J., Kawut,S.M., Kohl,B., Lee,J.C., Sonett,J., Christie,J.D. and Ware,L.B.
Journal Transl Res 160 (6), 435-442 (2012)
Title The decidual stromal cells-secreted CCL2 induces and maintains decidual leukocytes into Th2 bias in human early pregnancy .
Author He,Y.Y., He,X.J., Guo,P.F., Du,M.R., Shao,J., Li,M.Q. and Li,D.J.
Journal Clin. Immunol. 145 (2), 161-173 (2012)
Title Normal ageing is associated with an increase in Th2 cells, MCP-1 (CCL1) and RANTES (CCL5), with differences in sCD40L and PDGF-AA between sexes .
Author Mansfield,A.S., Nevala,W.K., Dronca,R.S., Leontovich,A.A., Shuster,L. and Markovic,S.N.
Journal Clin. Exp. Immunol. 170 (2), 186-193 (2012)
Title Assignment of the human small inducible cytokine A2 gene, SCYA2 (encoding JE or MCP-1), to 17q11.2-12: evolutionary relatedness of cytokines clustered at the same locus .
Author Rollins,B.J., Morton,C.C., Ledbetter,D.H., Eddy,R.L. Jr. and Shows,T.B.
Journal Genomics 10 (2), 489-492 (1991)
Title Modeling the three-dimensional structure of the monocyte chemo-attractant and activating protein MCAF/MCP-1 on the basis of the solution structure of interleukin-8 .
Author Gronenborn,A.M. and Clore,G.M.
Journal Protein Eng. 4 (3), 263-269 (1991)
Title Localization of monocyte chemotactic protein-1 gene (SCYA2) to human chromosome 17q11.2-q21.1 .
Author Mehrabian,M., Sparkes,R.S., Mohandas,T., Fogelman,A.M. and Lusis,A.J.
Journal Genomics 9 (1), 200-203 (1991)
Title Human monocyte chemoattractant protein-1 (MCP-1) .
Author Yoshimura,T. and Leonard,E.J.
Journal Adv. Exp. Med. Biol. 305, 47-56 (1991)
Title Identification of the monocyte chemotactic protein from human osteosarcoma cells and monocytes: detection of a novel N-terminally processed form .
Author Decock,B., Conings,R., Lenaerts,J.P., Billiau,A. and Van Damme,J.
Journal Biochem. Biophys. Res. Commun. 167 (3), 904-909 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878