• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18411 Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu18411C Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002982.3, 56119169
Length 300 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA.
Product C-C motif chemokine 2 precursor
Comment

Summary: This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and basophils but not for neutrophils or eosinophils. It has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis and atherosclerosis. It binds to chemokine receptors CCR2 and CCR4. [provided by RefSeq, Jul 2013].

RefSeq NP_002973.1
CDS 74..373
Misc Feature(1)143..145
Misc Feature(2)152..154
Misc Feature(3)152..154
Misc Feature(4)152..154
Misc Feature(5)164..166
Misc Feature(6)173..346
Misc Feature(7)order(173..187,191..214,245..250,314..346)
Misc Feature(8)order(179..181,185..187,224..226,230..232,248..250,
Misc Feature(9)order(179..181,185..187,239..241,245..250,266..268,
Misc Feature(10)order(179..181,266..268,293..295)
Misc Feature(11)order(179..187,191..214)
Misc Feature(12)179..181
Misc Feature(13)order(185..187,224..226,230..232,263..265,269..271,
Misc Feature(14)order(191..199,206..214,281..283,287..289)
Misc Feature(15)194..196
Misc Feature(16)197..199
Misc Feature(17)212..214
Misc Feature(18)order(230..232,254..256,308..310,314..316,323..328,
Misc Feature(19)245..250
Misc Feature(20)245..247
Misc Feature(21)254..256
Misc Feature(22)order(275..277,281..283)
Misc Feature(23)287..289
Misc Feature(24)314..316
Misc Feature(25)338..340
Exon (1)1..149
Gene:CCL2
Gene Synonym:GDCF-2; HC11; HSMCR30; MCAF; MCP-1; MCP1; SCYA2; SMC-CF
Exon (2)150..267
Gene:CCL2
Gene Synonym:GDCF-2; HC11; HSMCR30; MCAF; MCP-1; MCP1; SCYA2; SMC-CF
Exon (3)268..749
Gene:CCL2
Gene Synonym:GDCF-2; HC11; HSMCR30; MCAF; MCP-1; MCP1; SCYA2; SMC-CF
Translation MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
37+a, cdbSNP:369439824
56+c, tdbSNP:141271352
56+c, tdbSNP:386465599
68+a, tdbSNP:370016526
110+a, gdbSNP:144450837
129+c, tdbSNP:374418259
155+dbSNP:
155+a, gdbSNP:146604396
178+c, tdbSNP:4586
193+c, tdbSNP:371187910
195+a, gdbSNP:145056785
217+c, tdbSNP:138768575
219+c, tdbSNP:148937652
238+c, tdbSNP:143644230
278+dbSNP:
278+a, gdbSNP:148285031
284+a, gdbSNP:190996557
363+c, tdbSNP:199565451
364+a, gdbSNP:368861512
383+c, tdbSNP:376859120
407+a, tdbSNP:373290550
415+g, tdbSNP:181021073
438+c, tdbSNP:13900
545+g, tdbSNP:186178409
597+a, cdbSNP:191032356
598+a, gdbSNP:2215182
655+a, tdbSNP:75284178
657+a, tdbSNP:75433364
Gene SymbolCCL2
Gene SynonymGDCF-2; HC11; HSMCR30; MCAF; MCP-1; MCP1; SCYA2; SMC-CF
Chromosome17
Locus Map17q11.2-q12
Title MCP-1and IL-1beta expression in the myocardia of two young patients with Type 1 diabetes mellitus and fatal diabetic ketoacidosis .
Author Niu J, Gilliland MG, Jin Z, Kolattukudy PE and Hoffman WH.
Journal Exp. Mol. Pathol. 96 (1), 71-79 (2014)
Title Chemokine-chemokine receptor CCL2-CCR2 and CX3CL1-CX3CR1 axis may play a role in the aggravated inflammation in primary biliary cirrhosis .
Author Sasaki M, Miyakoshi M, Sato Y and Nakanuma Y.
Journal Dig. Dis. Sci. 59 (2), 358-364 (2014)
Title [Association of chemokines and their receptors genes polymorphisms with risk of myocardial infarction] .
Author Xu X, Wang LH, Liu HB, Xu CF, Zhang P, Yong F and Shi YP.
Journal Zhonghua Yi Xue Yi Chuan Xue Za Zhi 30 (5), 601-607 (2013)
Title Expression of CC chemokines CCL2, CCL5, and CCL11 is associated with duration of disease and complications in type-1 diabetes: a study on Iranian diabetic patients .
Author Jamali Z, Nazari M, Khoramdelazad H, Hakimizadeh E, Mahmoodi M, Karimabad MN, Hassanshahi G, Rezaeian M, Balaei P, Darakhshan S and Poor NM.
Journal Clin. Lab. 59 (9-10), 993-1001 (2013)
Title Association of inflammatory gene polymorphisms and conventional risk factors with arterial stiffness by age .
Author Kheradmand M, Niimura H, Kuwabara K, Nakahata N, Nakamura A, Ogawa S, Mantjoro EM, Shimatani K, Nerome Y, Owaki T, Kusano K and Takezaki T.
Journal J Epidemiol 23 (6), 457-465 (2013)
Title Assignment of the human small inducible cytokine A2 gene, SCYA2 (encoding JE or MCP-1), to 17q11.2-12: evolutionary relatedness of cytokines clustered at the same locus .
Author Rollins BJ, Morton CC, Ledbetter DH, Eddy RL Jr and Shows TB.
Journal Genomics 10 (2), 489-492 (1991)
Title Modeling the three-dimensional structure of the monocyte chemo-attractant and activating protein MCAF/MCP-1 on the basis of the solution structure of interleukin-8 .
Author Gronenborn AM and Clore GM.
Journal Protein Eng. 4 (3), 263-269 (1991)
Title Localization of monocyte chemotactic protein-1 gene (SCYA2) to human chromosome 17q11.2-q21.1 .
Author Mehrabian M, Sparkes RS, Mohandas T, Fogelman AM and Lusis AJ.
Journal Genomics 9 (1), 200-203 (1991)
Title Human monocyte chemoattractant protein-1 (MCP-1) .
Author Yoshimura T and Leonard EJ.
Journal Adv. Exp. Med. Biol. 305, 47-56 (1991)
Title Identification of the monocyte chemotactic protein from human osteosarcoma cells and monocytes: detection of a novel N-terminally processed form .
Author Decock B, Conings R, Lenaerts JP, Billiau A and Van Damme J.
Journal Biochem. Biophys. Res. Commun. 167 (3), 904-909 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.