• THAT   AND
  • THAT   AND


Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_002982 Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA. Full Lenth $220.40
ORF Sequence $159.00


RefSeq Version NM_002982.3, 56119169
Length 760 bp
Structure linear
Update Date 01-MAY-2011
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) ligand 2 (CCL2), mRNA.
Product C-C motif chemokine 2 precursor
Comment

Summary: This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes and basophils but not for neutrophils or eosinophils. It has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis and atherosclerosis. It binds to chemokine receptors CCR2 and CCR4. [provided by RefSeq].

RefSeq NP_002973.1
CDS 74..373
Exon (1)1..149
Exon (2)1..149
Exon (3)150..267
Exon (4)268..749
Translation MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
52+a, gdbSNP:79290195
178+c, tdbSNP:4586
267+, largedeletiondbSNP:71753651
438+c, tdbSNP:13900
complement(598)-g, adbSNP:2215182
655+a, tdbSNP:75284178
657+a, tdbSNP:75433364
657+, ttdbSNP:71804933
Gene SymbolCCL2
Gene SynonymGDCF-2; HC11; HSMCR30; MCAF; MCP-1; MCP1; MGC9434; SCYA2; SMC-CF
Chromosome17
Locus Map17q11.2-q12
All Transcripts NM_002982
Title Chemokine transcripts as targets of the RNA-binding protein HuR in human airway epithelium .
Author Fan,J., Ishmael,F.T., Fang,X., Myers,A., Cheadle,C., Huang,S.K., Atasoy,U., Gorospe,M. and Stellato,C.
Journal J. Immunol. 186 (4), 2482-2494 (2011)
Title FSP1+ fibroblasts promote skin carcinogenesis by maintaining MCP-1-mediated macrophage infiltration and chronic inflammation .
Author Zhang,J., Chen,L., Xiao,M., Wang,C. and Qin,Z.
Journal Am. J. Pathol. 178 (1), 382-390 (2011)
Title CCL2 expression in primary ovarian carcinoma is correlated with chemotherapy response and survival outcomes .
Author Fader,A.N., Rasool,N., Vaziri,S.A., Kozuki,T., Faber,P.W., Elson,P., Biscotti,C.V., Michener,C.M., Rose,P.G., Rojas-Espaillat,L., Belinson,J.L., Ganapathi,M.K. and Ganapathi,R.
Journal Anticancer Res. 30 (12), 4791-4798 (2010)
Title Reactive oxygen species-activated p38/ERK 1/2 MAPK signaling pathway in the Mycobacterium bovis bacillus Calmette Guerin (BCG)-induced CCL2 secretion in human monocytic cell line THP-1 .
Author Mendez-Samperio,P., Perez,A. and Alba,L.
Journal Arch. Med. Res. 41 (8), 579-585 (2010)
Title Combined association of CCR2-V64I and MCP-1-2518A/G polymorphisms with generalised aggressive periodontitis in Chinese .
Author Zhu,X.L., Meng,H.X., Xu,L., Zhang,L., Chen,Z.B., Shi,D. and Feng,X.H.
Journal Chin J Dent Res 13 (2), 109-114 (2010)
Title Assignment of the human small inducible cytokine A2 gene, SCYA2 (encoding JE or MCP-1), to 17q11.2-12: evolutionary relatedness of cytokines clustered at the same locus .
Author Rollins,B.J., Morton,C.C., Ledbetter,D.H., Eddy,R.L. Jr. and Shows,T.B.
Journal Genomics 10 (2), 489-492 (1991)
Title Modeling the three-dimensional structure of the monocyte chemo-attractant and activating protein MCAF/MCP-1 on the basis of the solution structure of interleukin-8 .
Author Gronenborn,A.M. and Clore,G.M.
Journal Protein Eng. 4 (3), 263-269 (1991)
Title Localization of monocyte chemotactic protein-1 gene (SCYA2) to human chromosome 17q11.2-q21.1 .
Author Mehrabian,M., Sparkes,R.S., Mohandas,T., Fogelman,A.M. and Lusis,A.J.
Journal Genomics 9 (1), 200-203 (1991)
Title Human monocyte chemoattractant protein-1 (MCP-1) .
Author Yoshimura,T. and Leonard,E.J.
Journal Adv. Exp. Med. Biol. 305, 47-56 (1991)
Title Identification of the monocyte chemotactic protein from human osteosarcoma cells and monocytes: detection of a novel N-terminally processed form .
Author Decock,B., Conings,R., Lenaerts,J.P., Billiau,A. and Van Damme,J.
Journal Biochem. Biophys. Res. Commun. 167 (3), 904-909 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878