• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-C motif) ligand 4 (CCL4), mRNA.


RefSeq Accession Definition Services Price Order
NM_002984 Homo sapiens chemokine (C-C motif) ligand 4 (CCL4), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002984.2, 90704850
Length 667 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) ligand 4 (CCL4), mRNA.
Product C-C motif chemokine 4 precursor
Comment

Summary: The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions. [provided by RefSeq, Dec 2012].

RefSeq NP_002975.1
CDS 80..358
Misc Feature(1)53..55
Misc Feature(2)152..154
Misc Feature(3)179..349
Misc Feature(4)order(179..193,197..220,248..253,317..349)
Misc Feature(5)order(185..187,191..193,230..232,236..238,251..253,
Misc Feature(6)order(185..187,191..193,242..244,248..253,269..271,
Misc Feature(7)order(185..187,269..271,296..298)
Misc Feature(8)order(185..193,197..220)
Misc Feature(9)order(191..193,230..232,236..238,266..268,272..274,
Misc Feature(10)order(197..205,212..220,284..286,290..292)
Misc Feature(11)order(236..238,257..259,311..313,317..319,326..331,
Misc Feature(12)248..253
Misc Feature(13)order(278..280,284..286)
Exon (1)1..155
Gene:CCL4
Gene Synonym:ACT2; AT744.1; G-26; HC21; LAG-1; LAG1; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4
Exon (2)156..270
Gene:CCL4
Gene Synonym:ACT2; AT744.1; G-26; HC21; LAG-1; LAG1; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4
Exon (3)271..667
Gene:CCL4
Gene Synonym:ACT2; AT744.1; G-26; HC21; LAG-1; LAG1; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4
Translation MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ PAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
17+a, gdbSNP:2905541
50+c, gdbSNP:137963281
68+g, tdbSNP:1049750
91+a, cdbSNP:199619169
94+c, gdbSNP:149488954
103+c, gdbSNP:146515425
113+a, gdbSNP:9635771
127+c, tdbSNP:62079739
138+c, tdbSNP:1130750
141+c, tdbSNP:143966312
142+a, gdbSNP:1130755
155+a, gdbSNP:150142971
196+dbSNP:
196+c, tdbSNP:1719146
197+a, gdbSNP:200881527
206+c, gdbSNP:149276903
210+a, cdbSNP:200124119
246+g, tdbSNP:3210001
258+a, gdbSNP:146953505
269+c, gdbSNP:137950182
271+dbSNP:
271+a, gdbSNP:202017534
283+a, gdbSNP:201503735
287+a, gdbSNP:1130760
301+c, tdbSNP:1049804
307+c, tdbSNP:1049805
316+a, gdbSNP:1049807
317+a, tdbSNP:1719152
377+g, tdbSNP:181269866
388+a, gdbSNP:200241576
402+c, tdbSNP:1049811
420+a, cdbSNP:1049813
422+a, gdbSNP:1049815
464+c, tdbSNP:1049819
476+g, tdbSNP:1049821
483+c, tdbSNP:1049823
493+c, tdbSNP:111543488
494+c, tdbSNP:1049824
497+a, gdbSNP:1049826
514+c, tdbSNP:1049828
525+c, tdbSNP:184099447
576+c, gdbSNP:1049833
582+c, gdbSNP:1049834
592+a, tdbSNP:143747443
597+c, tdbSNP:148133700
615+a, gdbSNP:1049837
618+a, tdbSNP:1049838
624+c, tdbSNP:1049839
625+a, gdbSNP:1049840
Gene SymbolCCL4
Gene SynonymACT2; AT744.1; G-26; HC21; LAG-1; LAG1; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4
Chromosome17
Locus Map17q12
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002984 Homo sapiens chemokine (C-C motif) ligand 4 (CCL4), mRNA. Full Length $193.43
ORF Sequence $159.00
Title Tumor-infiltrating monocytic myeloid-derived suppressor cells mediate CCR5-dependent recruitment of regulatory T cells favoring tumor growth .
Author Schlecker,E., Stojanovic,A., Eisen,C., Quack,C., Falk,C.S., Umansky,V. and Cerwenka,A.
Journal J. Immunol. 189 (12), 5602-5611 (2012)
Title IL-27 enhances LPS-induced proinflammatory cytokine production via upregulation of TLR4 expression and signaling in human monocytes .
Author Guzzo,C., Ayer,A., Basta,S., Banfield,B.W. and Gee,K.
Journal J. Immunol. 188 (2), 864-873 (2012)
Title Dysregulated CC receptor/ligand in monocytes/macrophages from tongue squamous cell carcinoma patients is partially rectified by interferon alpha-2b .
Author Chakraborty,K., Bose,A., Goswami,K.K., Mukherjee,K.K., Goswami,S., Ghosh,D., Chakraborty,T., Sarkar,K., Pal,S., Bhowmick,A., Biswas,J. and Baral,R.
Journal Hum. Immunol. 73 (1), 38-47 (2012)
Title The expansion ability but not the quality of HIV-specific CD8(+) T cells is associated with protective human leucocyte antigen class I alleles in long-term non-progressors .
Author Lopez,M., Peris,A., Soriano,V., Lozano,S., Vicario,J.L., Rallon,N.I., Restrepo,C. and Benito,J.M.
Journal Immunology 134 (3), 305-313 (2011)
Title Epidemic of hepatitis B with high mortality in India: association of fulminant disease with lack of CCL4 and natural killer T cells .
Author Tripathy,A.S., Das,R., Chadha,M.S. and Arankalle,V.A.
Journal J. Viral Hepat. 18 (10), E415-E422 (2011)
Title The gene encoding the Act-2 cytokine. Genomic structure, HTLV-I/Tax responsiveness of 5' upstream sequences, and chromosomal localization .
Author Napolitano,M., Modi,W.S., Cevario,S.J., Gnarra,J.R., Seuanez,H.N. and Leonard,W.J.
Journal J. Biol. Chem. 266 (26), 17531-17536 (1991)
Title Cloning and expression of a lymphocyte activation gene (LAG-1) .
Author Baixeras,E., Roman-Roman,S., Jitsukawa,S., Genevee,C., Mechiche,S., Viegas-Pequignot,E., Hercend,T. and Triebel,F.
Journal Mol. Immunol. 27 (11), 1091-1102 (1990)
Title Two inflammatory mediator cytokine genes are closely linked and variably amplified on chromosome 17q .
Author Irving,S.G., Zipfel,P.F., Balke,J., McBride,O.W., Morton,C.C., Burd,P.R., Siebenlist,U. and Kelly,K.
Journal Nucleic Acids Res. 18 (11), 3261-3270 (1990)
Title A family of small inducible proteins secreted by leukocytes are members of a new superfamily that includes leukocyte and fibroblast-derived inflammatory agents, growth factors, and indicators of various activation processes .
Author Brown,K.D., Zurawski,S.M., Mosmann,T.R. and Zurawski,G.
Journal J. Immunol. 142 (2), 679-687 (1989)
Title Identification, cloning, and characterization of an immune activation gene .
Author Lipes,M.A., Napolitano,M., Jeang,K.T., Chang,N.T. and Leonard,W.J.
Journal Proc. Natl. Acad. Sci. U.S.A. 85 (24), 9704-9708 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878