• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-C motif) ligand 4 (CCL4), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18687 Homo sapiens chemokine (C-C motif) ligand 4 (CCL4), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu18687C Homo sapiens chemokine (C-C motif) ligand 4 (CCL4), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002984.2, 90704850
Length 279 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) ligand 4 (CCL4), mRNA.
Product C-C motif chemokine 4 precursor
Comment

Summary: The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions. [provided by RefSeq, Dec 2012].

RefSeq NP_002975.1
CDS 80..358
Misc Feature(1)53..55
Misc Feature(2)152..154
Misc Feature(3)179..349
Misc Feature(4)order(179..193,197..220,248..253,317..349)
Misc Feature(5)order(185..187,191..193,230..232,236..238,251..253,
Misc Feature(6)order(185..187,191..193,242..244,248..253,269..271,
Misc Feature(7)order(185..187,269..271,296..298)
Misc Feature(8)order(185..193,197..220)
Misc Feature(9)order(191..193,230..232,236..238,266..268,272..274,
Misc Feature(10)order(197..205,212..220,284..286,290..292)
Misc Feature(11)order(236..238,257..259,311..313,317..319,326..331,
Misc Feature(12)248..253
Misc Feature(13)order(278..280,284..286)
Exon (1)1..155
Gene:CCL4
Gene Synonym:ACT2; AT744.1; G-26; HC21; LAG-1; LAG1; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4
Exon (2)156..270
Gene:CCL4
Gene Synonym:ACT2; AT744.1; G-26; HC21; LAG-1; LAG1; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4
Exon (3)271..667
Gene:CCL4
Gene Synonym:ACT2; AT744.1; G-26; HC21; LAG-1; LAG1; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4
Translation MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ PAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
17+a, gdbSNP:2905541
50+c, gdbSNP:137963281
68+g, tdbSNP:1049750
75+a, gdbSNP:372846688
91+a, cdbSNP:199619169
94+c, gdbSNP:149488954
103+c, gdbSNP:146515425
113+a, gdbSNP:1049752
113+a, gdbSNP:9635771
125+a, gdbSNP:370817313
127+c, tdbSNP:62079739
131+c, tdbSNP:368788496
138+a, gdbSNP:4113763
138+c, tdbSNP:1130750
141+c, tdbSNP:143966312
142+a, gdbSNP:1130755
155+a, gdbSNP:150142971
191+dbSNP:
191+c, tdbSNP:376875441
196+c, tdbSNP:1719146
197+a, gdbSNP:200881527
206+c, gdbSNP:149276903
210+a, cdbSNP:200124119
226+a, gdbSNP:371362421
258+a, gdbSNP:146953505
269+c, gdbSNP:137950182
271+dbSNP:
271+a, gdbSNP:202017534
283+a, gdbSNP:201503735
316..317+at, gadbSNP:386796798
316+a, gdbSNP:1049807
317+a, tdbSNP:1719152
334+a, cdbSNP:371375580
335+a, gdbSNP:374631046
377+g, tdbSNP:181269866
388+a, gdbSNP:200241576
390+a, gdbSNP:367933726
402+c, tdbSNP:1049811
403+a, gdbSNP:372180205
464+c, tdbSNP:1049819
476+g, tdbSNP:1049821
483+c, tdbSNP:1049823
493+c, tdbSNP:111543488
494+c, tdbSNP:1049824
497+a, gdbSNP:1049826
514+c, tdbSNP:1049828
525+c, tdbSNP:184099447
576+c, gdbSNP:1049833
582+c, gdbSNP:1049834
592+a, tdbSNP:143747443
complement(597)-t, cdbSNP:148133700
615+a, gdbSNP:1049837
618+a, tdbSNP:1049838
624+c, tdbSNP:1049839
625+a, gdbSNP:1049840
640+, adbSNP:373855600
Gene SymbolCCL4
Gene SynonymACT2; AT744.1; G-26; HC21; LAG-1; LAG1; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4
Chromosome17
Locus Map17q12
Title Dynamics of chemokine, cytokine, and growth factor serum levels in BRAF-mutant melanoma patients during BRAF inhibitor treatment .
Author Wilmott JS, Haydu LE, Menzies AM, Lum T, Hyman J, Thompson JF, Hersey P, Kefford RF, Scolyer RA and Long GV.
Journal J. Immunol. 192 (5), 2505-2513 (2014)
Title 27-Hydroxycholesterol and 7alpha-hydroxycholesterol trigger a sequence of events leading to migration of CCR5-expressing Th1 lymphocytes .
Author Kim SM, Kim BY, Lee SA, Eo SK, Yun Y, Kim CD and Kim K.
Journal Toxicol. Appl. Pharmacol. 274 (3), 462-470 (2014)
Title Human T cell leukaemia virus type 2 tax protein mediates CC-chemokine expression in peripheral blood mononuclear cells via the nuclear factor kappa B canonical pathway .
Author Barrios CS, Castillo L, Zhi H, Giam CZ and Beilke MA.
Journal Clin. Exp. Immunol. 175 (1), 92-103 (2014)
Title The association between CCL2 polymorphisms and drug-resistant epilepsy in Chinese children .
Author He X, Li Y, Liu Z, Yue X, Zhao P, Hu J, Wu G, Mao B, Sun D, Zhang H, Song X, Wang Y and Shao J.
Journal Epileptic Disord 15 (3), 272-277 (2013)
Title Autocrine CCL3 and CCL4 induced by the oncoprotein LMP1 promote Epstein-Barr virus-triggered B cell proliferation .
Author Tsai SC, Lin SJ, Lin CJ, Chou YC, Lin JH, Yeh TH, Chen MR, Huang LM, Lu MY, Huang YC, Chen HY and Tsai CH.
Journal J. Virol. 87 (16), 9041-9052 (2013)
Title The gene encoding the Act-2 cytokine. Genomic structure, HTLV-I/Tax responsiveness of 5' upstream sequences, and chromosomal localization .
Author Napolitano M, Modi WS, Cevario SJ, Gnarra JR, Seuanez HN and Leonard WJ.
Journal J. Biol. Chem. 266 (26), 17531-17536 (1991)
Title Cloning and expression of a lymphocyte activation gene (LAG-1) .
Author Baixeras E, Roman-Roman S, Jitsukawa S, Genevee C, Mechiche S, Viegas-Pequignot E, Hercend T and Triebel F.
Journal Mol. Immunol. 27 (11), 1091-1102 (1990)
Title Two inflammatory mediator cytokine genes are closely linked and variably amplified on chromosome 17q .
Author Irving SG, Zipfel PF, Balke J, McBride OW, Morton CC, Burd PR, Siebenlist U and Kelly K.
Journal Nucleic Acids Res. 18 (11), 3261-3270 (1990)
Title A family of small inducible proteins secreted by leukocytes are members of a new superfamily that includes leukocyte and fibroblast-derived inflammatory agents, growth factors, and indicators of various activation processes .
Author Brown KD, Zurawski SM, Mosmann TR and Zurawski G.
Journal J. Immunol. 142 (2), 679-687 (1989)
Title Identification, cloning, and characterization of an immune activation gene .
Author Lipes MA, Napolitano M, Jeang KT, Chang NT and Leonard WJ.
Journal Proc. Natl. Acad. Sci. U.S.A. 85 (24), 9704-9708 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.