• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002988 Homo sapiens chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), mRNA. GenEZ ORF Cloning On-demand $299.00 14

*Business Day

Related Services

RefSeq Version NM_002988.2, 22547150
Length 793 bp
Structure linear
Update Date 20-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), mRNA.
Product C-C motif chemokine 18 precursor
Comment

Summary: This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses. [provided by RefSeq, Jul 2008].

RefSeq NP_002979.1
CDS 61..330
Misc Feature(1)34..36
Misc Feature(2)148..318
Misc Feature(3)order(148..162,166..189,217..222,286..318)
Misc Feature(4)order(154..156,160..162,199..201,205..207,220..222,
Misc Feature(5)order(154..156,160..162,211..213,217..222,238..240,
Misc Feature(6)order(154..156,238..240,265..267)
Misc Feature(7)order(154..162,166..189)
Misc Feature(8)order(160..162,199..201,205..207,235..237,241..243,
Misc Feature(9)order(166..174,181..189,253..255,259..261)
Misc Feature(10)order(205..207,226..228,280..282,286..288,295..300,
Misc Feature(11)217..222
Misc Feature(12)order(247..249,253..255)
Exon (1)1..127
Gene:CCL18
Gene Synonym:AMAC-1; AMAC1; CKb7; DC-CK1; DCCK1; MIP-4; PARC; SCYA18
Exon (2)128..239
Gene:CCL18
Gene Synonym:AMAC-1; AMAC1; CKb7; DC-CK1; DCCK1; MIP-4; PARC; SCYA18
Exon (3)240..770
Gene:CCL18
Gene Synonym:AMAC-1; AMAC1; CKb7; DC-CK1; DCCK1; MIP-4; PARC; SCYA18
Translation MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVI LLTKRGRQICADPNKKWVQKYISDLKLNA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
73+a, gdbSNP:374115816
79+a, gdbSNP:73290772
80+c, tdbSNP:377682562
90+c, gdbSNP:369599857
152+dbSNP:
152+g, tdbSNP:377474798
157+a, gdbSNP:138061691
186+a, gdbSNP:201008180
216+c, tdbSNP:370369732
280+dbSNP:
280+a, gdbSNP:149506889
281+a, gdbSNP:150076657
288+a, gdbSNP:200043307
297+c, gdbSNP:148220878
310+a, gdbSNP:374733570
346+c, tdbSNP:369185675
372+c, tdbSNP:371605708
376+a, tdbSNP:138678712
424+a, gdbSNP:386531583
complement(424)-g, adbSNP:14304
510+c, tdbSNP:113206976
520+c, tdbSNP:142865584
581+a, gdbSNP:766555
608+a, gdbSNP:766556
696+g, tdbSNP:374302530
758+a, g, tdbSNP:111899690
Gene SymbolCCL18
Gene SynonymAMAC-1; AMAC1; CKb7; DC-CK1; DCCK1; MIP-4; PARC; SCYA18
Chromosome17
Locus Map17q11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002988 Homo sapiens chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), mRNA. On-demand $299.00 14
Title Genome-wide association study of lung function phenotypes in a founder population .
Author Yao TC, Du G, Han L, Sun Y, Hu D, Yang JJ, Mathias R, Roth LA, Rafaels N, Thompson EE, Loisel DA, Anderson R, Eng C, Arruabarrena Orbegozo M, Young M, Klocksieben JM, Anderson E, Shanovich K, Lester LA, Williams LK, Barnes KC, Burchard EG, Nicolae DL, Abney M and Ober C.
Journal J. Allergy Clin. Immunol. 133 (1), 248-255 (2014)
Title Nir1 promotes invasion of breast cancer cells by binding to chemokine (C-C motif) ligand 18 through the PI3K/Akt/GSK3beta/Snail signalling pathway .
Author Zhang B, Yin C, Li H, Shi L, Liu N, Sun Y, Lu S, Liu Y, Sun L, Li X, Chen W and Qi Y.
Journal Eur. J. Cancer 49 (18), 3900-3913 (2013)
Title The disulfide bond between cysteine 10 and cysteine 34 is required for CCL18 activity .
Author Legendre B, Tokarski C, Chang Y, De Freitas Caires N, Lortat-Jacob H, Nadai PD, Rolando C, Duez C, Tsicopoulos A and Lassalle P.
Journal Cytokine 64 (1), 463-470 (2013)
Title Identification of human CCR8 as a CCL18 receptor .
Author Islam SA, Ling MF, Leung J, Shreffler WG and Luster AD.
Journal J. Exp. Med. 210 (10), 1889-1898 (2013)
Title Role of CCL18 in asthma and lung immunity .
Author Tsicopoulos A, Chang Y, Ait Yahia S, de Nadai P and Chenivesse C.
Journal Clin. Exp. Allergy 43 (7), 716-722 (2013)
Title Chemokine PARC gene (SCYA18) generated by fusion of two MIP-1alpha/LD78alpha-like genes .
Author Tasaki Y, Fukuda S, Iio M, Miura R, Imai T, Sugano S, Yoshie O, Hughes AL and Nomiyama H.
Journal Genomics 55 (3), 353-357 (1999)
Title Alternative macrophage activation-associated CC-chemokine-1, a novel structural homologue of macrophage inflammatory protein-1 alpha with a Th2-associated expression pattern .
Author Kodelja V, Muller C, Politz O, Hakij N, Orfanos CE and Goerdt S.
Journal J. Immunol. 160 (3), 1411-1418 (1998)
Title A novel human CC chemokine PARC that is most homologous to macrophage-inflammatory protein-1 alpha/LD78 alpha and chemotactic for T lymphocytes, but not for monocytes .
Author Hieshima K, Imai T, Baba M, Shoudai K, Ishizuka K, Nakagawa T, Tsuruta J, Takeya M, Sakaki Y, Takatsuki K, Miura R, Opdenakker G, Van Damme J, Yoshie O and Nomiyama H.
Journal J. Immunol. 159 (3), 1140-1149 (1997)
Title A dendritic-cell-derived C-C chemokine that preferentially attracts naive T cells .
Author Adema GJ, Hartgers F, Verstraten R, de Vries E, Marland G, Menon S, Foster J, Xu Y, Nooyen P, McClanahan T, Bacon KB and Figdor CG.
Journal Nature 387 (6634), 713-717 (1997)
Title The chemokine information source: identification and characterization of novel chemokines using the WorldWideWeb and expressed sequence tag databases .
Author Wells TN and Peitsch MC.
Journal J. Leukoc. Biol. 61 (5), 545-550 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.