• THAT   AND
  • THAT   AND


Homo sapiens chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_002988 Homo sapiens chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), mRNA. Full Lenth $229.97
ORF Sequence $159.00


RefSeq Version NM_002988.2, 22547150
Length 793 bp
Structure linear
Update Date 12-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), mRNA.
Product C-C motif chemokine 18 precursor
Comment

Summary: This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses. [provided by RefSeq].

RefSeq NP_002979.1
CDS 61..330
Exon (1)1..127
Exon (2)1..127
Exon (3)128..239
Exon (4)240..770
Translation MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVI LLTKRGRQICADPNKKWVQKYISDLKLNA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
79+a, gdbSNP:73290772
complement(424)-g, adbSNP:14304
510+c, tdbSNP:113206976
complement(581)-g, adbSNP:766555
complement(608)-g, adbSNP:766556
736+a, tdbSNP:79757499
758+a, tdbSNP:111899690
Gene SymbolCCL18
Gene SynonymAMAC-1; AMAC1; CKb7; DC-CK1; DCCK1; MIP-4; PARC; SCYA18
Chromosome17
Locus Map17q11.2
All Transcripts NM_002988
Title Cardiovascular determinants and prognostic significance of CC Chemokine Ligand-18 (CCL18/PARC) in patients with stable coronary artery disease .
Author De Sutter,J., Struyf,S., Van de Veire,N.R., Philippe,J., De Buyzere,M. and Van Damme,J.
Journal J. Mol. Cell. Cardiol. 49 (5), 894-896 (2010)
Title Attenuation of CXCR4 responses by CCL18 in acute lymphocytic leukemia B cells .
Author Catusse,J., Wollner,S., Leick,M., Schrottner,P., Schraufstatter,I. and Burger,M.
Journal J. Cell. Physiol. 225 (3), 792-800 (2010)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Chemokine CCL18 predicts intraventricular hemorrhage in very preterm infants .
Author Kallankari,H., Kaukola,T., Ojaniemi,M., Herva,R., Perhomaa,M., Vuolteenaho,R., Kingsmore,S.F. and Hallman,M.
Journal Ann. Med. 42 (6), 416-425 (2010)
Title Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls .
Author Schuurhof,A., Bont,L., Siezen,C.L., Hodemaekers,H., van Houwelingen,H.C., Kimman,T.G., Hoebee,B., Kimpen,J.L. and Janssen,R.
Journal Pediatr. Pulmonol. 45 (6), 608-613 (2010)
Title Chemokine PARC gene (SCYA18) generated by fusion of two MIP-1alpha/LD78alpha-like genes .
Author Tasaki,Y., Fukuda,S., Iio,M., Miura,R., Imai,T., Sugano,S., Yoshie,O., Hughes,A.L. and Nomiyama,H.
Journal Genomics 55 (3), 353-357 (1999)
Title Alternative macrophage activation-associated CC-chemokine-1, a novel structural homologue of macrophage inflammatory protein-1 alpha with a Th2-associated expression pattern .
Author Kodelja,V., Muller,C., Politz,O., Hakij,N., Orfanos,C.E. and Goerdt,S.
Journal J. Immunol. 160 (3), 1411-1418 (1998)
Title A novel human CC chemokine PARC that is most homologous to macrophage-inflammatory protein-1 alpha/LD78 alpha and chemotactic for T lymphocytes, but not for monocytes .
Author Hieshima,K., Imai,T., Baba,M., Shoudai,K., Ishizuka,K., Nakagawa,T., Tsuruta,J., Takeya,M., Sakaki,Y., Takatsuki,K., Miura,R., Opdenakker,G., Van Damme,J., Yoshie,O. and Nomiyama,H.
Journal J. Immunol. 159 (3), 1140-1149 (1997)
Title A dendritic-cell-derived C-C chemokine that preferentially attracts naive T cells .
Author Adema,G.J., Hartgers,F., Verstraten,R., de Vries,E., Marland,G., Menon,S., Foster,J., Xu,Y., Nooyen,P., McClanahan,T., Bacon,K.B. and Figdor,C.G.
Journal Nature 387 (6634), 713-717 (1997)
Title The chemokine information source: identification and characterization of novel chemokines using the WorldWideWeb and expressed sequence tag databases .
Author Wells,T.N. and Peitsch,M.C.
Journal J. Leukoc. Biol. 61 (5), 545-550 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878