• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-X-C motif) ligand 6 (CXCL6), mRNA.


RefSeq Accession Definition Services Price Order
NM_002993 Homo sapiens chemokine (C-X-C motif) ligand 6 (CXCL6), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002993.3, 194733730
Length 1677 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-X-C motif) ligand 6 (CXCL6), mRNA.
Product C-X-C motif chemokine 6 precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BP204144.1, AC108029.3 and U81234.1. On Jul 31, 2008 this sequence version replaced gi:52851409.

RefSeq NP_002984.1
CDS 196..540
Misc Feature(1)94..96
Misc Feature(2)331..516
Misc Feature(3)order(331..339,355..357,367..384,409..417,445..450,
Misc Feature(4)331..339
Misc Feature(5)order(334..336,343..345,382..387,394..402,430..441,
Misc Feature(6)order(334..336,343..345,394..396,400..402,430..432,
Misc Feature(7)order(337..342,346..348)
Misc Feature(8)order(343..363,367..384)
Misc Feature(9)order(349..354,358..360,367..369,379..381,436..438,
Misc Feature(10)order(370..372,376..378,478..480,487..489,493..504,
Misc Feature(11)order(376..378,385..387,442..444,448..450,457..462)
Misc Feature(12)order(382..387,397..399,433..435,439..441,469..471,
Misc Feature(13)409..417
Misc Feature(14)409..417
Misc Feature(15)448..456
Exon (1)1..304
Gene:CXCL6
Gene Synonym:CKA-3; GCP-2; GCP2; SCYB6
Exon (2)305..437
Gene:CXCL6
Gene Synonym:CKA-3; GCP-2; GCP2; SCYB6
Exon (3)438..521
Gene:CXCL6
Gene Synonym:CKA-3; GCP-2; GCP2; SCYB6
Exon (4)522..1659
Gene:CXCL6
Gene Synonym:CKA-3; GCP-2; GCP2; SCYB6
Translation MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNP KTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
26+dbSNP:
26+g, tdbSNP:193257415
209+c, gdbSNP:185031743
291+a, gdbSNP:200901978
297+c, tdbSNP:200457897
300+c, tdbSNP:146902260
350+dbSNP:
350+g, tdbSNP:151092747
409+a, gdbSNP:4608774
411+c, tdbSNP:141019869
415+a, cdbSNP:149811429
417+a, gdbSNP:145757947
428+c, tdbSNP:201941881
469+dbSNP:
469+c, gdbSNP:140549348
477+a, gdbSNP:145625563
498+a, gdbSNP:146538128
528+dbSNP:
528+c, tdbSNP:141128477
695+c, tdbSNP:113807832
881+c, tdbSNP:73828860
902+a, cdbSNP:188106137
955+a, cdbSNP:79466294
995+c, gdbSNP:116018952
1023..1024+, atdbSNP:35898842
1079+a, gdbSNP:60403178
1107+a, gdbSNP:148526735
1114+c, tdbSNP:141260283
1170+a, gdbSNP:180693327
1181+c, tdbSNP:16850073
1338+c, tdbSNP:150760732
1384+a, gdbSNP:184482233
1407+a, gdbSNP:76099474
1473+c, tdbSNP:1957077
1487+c, tdbSNP:190265451
Gene SymbolCXCL6
Gene SynonymCKA-3; GCP-2; GCP2; SCYB6
Chromosome4
Locus Map4q13.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002993 Homo sapiens chemokine (C-X-C motif) ligand 6 (CXCL6), mRNA. Full Length $486.33
ORF Sequence $159.00
Title Mesenchymal stem cells overexpressing GCP-2 improve heart function through enhanced angiogenic properties in a myocardial infarction model .
Author Kim,S.W., Lee,D.W., Yu,L.H., Zhang,H.Z., Kim,C.E., Kim,J.M., Park,T.H., Cha,K.S., Seo,S.Y., Roh,M.S., Lee,K.C., Jung,J.S. and Kim,M.H.
Journal Cardiovasc. Res. 95 (4), 495-506 (2012)
Title Isotypic neutralizing antibodies against mouse GCP-2/CXCL6 inhibit melanoma growth and metastasis .
Author Verbeke,H., Struyf,S., Berghmans,N., Van Coillie,E., Opdenakker,G., Uyttenhove,C., Van Snick,J. and Van Damme,J.
Journal Cancer Lett. 302 (1), 54-62 (2011)
Title Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility 'hot-spot' .
Author Johnatty,S.E., Beesley,J., Chen,X., Macgregor,S., Duffy,D.L., Spurdle,A.B., deFazio,A., Gava,N., Webb,P.M., Rossing,M.A., Doherty,J.A., Goodman,M.T., Lurie,G., Thompson,P.J., Wilkens,L.R., Ness,R.B., Moysich,K.B., Chang-Claude,J., Wang-Gohrke,S., Cramer,D.W., Terry,K.L., Hankinson,S.E., Tworoger,S.S., Garcia-Closas,M., Yang,H., Lissowska,J., Chanock,S.J., Pharoah,P.D., Song,H., Whitemore,A.S., Pearce,C.L., Stram,D.O., Wu,A.H., Pike,M.C., Gayther,S.A., Ramus,S.J., Menon,U., Gentry-Maharaj,A., Anton-Culver,H., Ziogas,A., Hogdall,E., Kjaer,S.K., Hogdall,C., Berchuck,A., Schildkraut,J.M., Iversen,E.S., Moorman,P.G., Phelan,C.M., Sellers,T.A., Cunningham,J.M., Vierkant,R.A., Rider,D.N., Goode,E.L., Haviv,I. and Chenevix-Trench,G.
Journal PLoS Genet. 6 (7), E1001016 (2010)
Title Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls .
Author Schuurhof,A., Bont,L., Siezen,C.L., Hodemaekers,H., van Houwelingen,H.C., Kimman,T.G., Hoebee,B., Kimpen,J.L. and Janssen,R.
Journal Pediatr. Pulmonol. 45 (6), 608-613 (2010)
Title Differential cytokine regulation by NF-kappaB and AP-1 in Jurkat T-cells .
Author Khalaf,H., Jass,J. and Olsson,P.E.
Journal BMC Immunol. 11, 26 (2010)
Title Localization of the human CXC chemokine subfamily on the long arm of chromosome 4 using radiation hybrids .
Author Modi,W.S. and Chen,Z.Q.
Journal Genomics 47 (1), 136-139 (1998)
Title Cloning and characterization of the human granulocyte chemotactic protein-2 gene .
Author Rovai,L.E., Herschman,H.R. and Smith,J.B.
Journal J. Immunol. 158 (11), 5257-5266 (1997)
Title Cloning, bacterial expression and biological characterization of recombinant human granulocyte chemotactic protein-2 and differential expression of granulocyte chemotactic protein-2 and epithelial cell-derived neutrophil activating peptide-78 mRNAs .
Author Froyen,G., Proost,P., Ronsse,I., Mitera,T., Haelens,A., Wuyts,A., Opdenakker,G., Van Damme,J. and Billiau,A.
Journal Eur. J. Biochem. 243 (3), 762-769 (1997)
Title Human and bovine granulocyte chemotactic protein-2: complete amino acid sequence and functional characterization as chemokines .
Author Proost,P., Wuyts,A., Conings,R., Lenaerts,J.P., Billiau,A., Opdenakker,G. and Van Damme,J.
Journal Biochemistry 32 (38), 10170-10177 (1993)
Title Identification of a novel granulocyte chemotactic protein (GCP-2) from human tumor cells. In vitro and in vivo comparison with natural forms of GRO, IP-10, and IL-8 .
Author Proost,P., De Wolf-Peeters,C., Conings,R., Opdenakker,G., Billiau,A. and Van Damme,J.
Journal J. Immunol. 150 (3), 1000-1010 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878