• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-X-C motif) ligand 6 (CXCL6), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu14703 Homo sapiens chemokine (C-X-C motif) ligand 6 (CXCL6), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu14703C Homo sapiens chemokine (C-X-C motif) ligand 6 (CXCL6), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002993.3, 194733730
Length 345 bp
Structure linear
Update Date 05-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-X-C motif) ligand 6 (CXCL6), mRNA.
Product C-X-C motif chemokine 6 precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BP204144.1, AC108029.3 and U81234.1. On Jul 31, 2008 this sequence version replaced gi:52851409.

RefSeq NP_002984.1
CDS 196..540
Misc Feature(1)94..96
Misc Feature(2)331..516
Misc Feature(3)order(331..339,355..357,367..384,409..417,445..450,
Misc Feature(4)331..339
Misc Feature(5)order(334..336,343..345,382..387,394..402,430..441,
Misc Feature(6)order(334..336,343..345,394..396,400..402,430..432,
Misc Feature(7)order(337..342,346..348)
Misc Feature(8)order(343..363,367..384)
Misc Feature(9)order(349..354,358..360,367..369,379..381,436..438,
Misc Feature(10)order(370..372,376..378,478..480,487..489,493..504,
Misc Feature(11)order(376..378,385..387,442..444,448..450,457..462)
Misc Feature(12)order(382..387,397..399,433..435,439..441,469..471,
Misc Feature(13)409..417
Misc Feature(14)409..417
Misc Feature(15)448..456
Exon (1)1..304
Gene:CXCL6
Gene Synonym:CKA-3; GCP-2; GCP2; SCYB6
Exon (2)305..437
Gene:CXCL6
Gene Synonym:CKA-3; GCP-2; GCP2; SCYB6
Exon (3)438..521
Gene:CXCL6
Gene Synonym:CKA-3; GCP-2; GCP2; SCYB6
Exon (4)522..1659
Gene:CXCL6
Gene Synonym:CKA-3; GCP-2; GCP2; SCYB6
Translation MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNP KTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
26+dbSNP:
26+g, tdbSNP:193257415
209+c, gdbSNP:185031743
219+g, tdbSNP:375976441
240+c, gdbSNP:370080580
255+a, gdbSNP:373291221
282+a, gdbSNP:377412241
291+a, gdbSNP:200901978
297+c, tdbSNP:200457897
300+c, tdbSNP:146902260
308+dbSNP:
308+g, tdbSNP:373993894
334+c, tdbSNP:367612330
350+g, tdbSNP:151092747
353+g, tdbSNP:370928506
404+c, tdbSNP:267600252
405+c, tdbSNP:267600253
409+a, gdbSNP:4608774
411+c, tdbSNP:141019869
415+a, cdbSNP:149811429
417+a, gdbSNP:145757947
428+c, tdbSNP:201941881
469+dbSNP:
469+c, gdbSNP:140549348
474+c, tdbSNP:372953502
477+a, gdbSNP:145625563
483+a, cdbSNP:372015132
498+a, gdbSNP:146538128
520+a, gdbSNP:377169766
528+dbSNP:
528+c, tdbSNP:141128477
553+a, cdbSNP:372544850
584+c, tdbSNP:374838254
682+g, tdbSNP:376565071
695+c, tdbSNP:113807832
881+c, tdbSNP:73828860
902+a, cdbSNP:188106137
955+a, cdbSNP:79466294
995+c, gdbSNP:116018952
1025..1026+, atdbSNP:370982225
1079+a, gdbSNP:60403178
1107+a, gdbSNP:148526735
1114+c, tdbSNP:141260283
1170+a, gdbSNP:180693327
1181+c, tdbSNP:16850073
1338+c, tdbSNP:150760732
1384+a, gdbSNP:184482233
1407+a, gdbSNP:76099474
1473+c, tdbSNP:1957077
1487+c, tdbSNP:190265451
Gene SymbolCXCL6
Gene SynonymCKA-3; GCP-2; GCP2; SCYB6
Chromosome4
Locus Map4q13.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002993 Homo sapiens chemokine (C-X-C motif) ligand 6 (CXCL6), mRNA. In-stock $99.00 5-7
Title The chemokine CXCL6 restricts human trophoblast cell migration and invasion by suppressing MMP-2 activity in the first trimester .
Author Zhang H, Hou L, Li CM and Zhang WY.
Journal Hum. Reprod. 28 (9), 2350-2362 (2013)
Title Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease .
Author Jostins L, Ripke S, Weersma RK, Duerr RH, McGovern DP, Hui KY, Lee JC, Schumm LP, Sharma Y, Anderson CA, Essers J, Mitrovic M, Ning K, Cleynen I, Theatre E, Spain SL, Raychaudhuri S, Goyette P, Wei Z, Abraham C, Achkar JP, Ahmad T, Amininejad L, Ananthakrishnan AN, Andersen V, Andrews JM, Baidoo L, Balschun T, Bampton PA, Bitton A, Boucher G, Brand S, Buning C, Cohain A, Cichon S, D'Amato M, De Jong D, Devaney KL, Dubinsky M, Edwards C, Ellinghaus D, Ferguson LR, Franchimont D, Fransen K, Gearry R, Georges M, Gieger C, Glas J, Haritunians T, Hart A, Hawkey C, Hedl M, Hu X, Karlsen TH, Kupcinskas L, Kugathasan S, Latiano A, Laukens D, Lawrance IC, Lees CW, Louis E, Mahy G, Mansfield J, Morgan AR, Mowat C, Newman W, Palmieri O, Ponsioen CY, Potocnik U, Prescott NJ, Regueiro M, Rotter JI, Russell RK, Sanderson JD, Sans M, Satsangi J, Schreiber S, Simms LA, Sventoraityte J, Targan SR, Taylor KD, Tremelling M, Verspaget HW, De Vos M, Wijmenga C, Wilson DC, Winkelmann J, Xavier RJ, Zeissig S, Zhang B, Zhang CK, Zhao H, Silverberg MS, Annese V, Hakonarson H, Brant SR, Radford-Smith G, Mathew CG, Rioux JD, Schadt EE, Daly MJ, Franke A, Parkes M, Vermeire S, Barrett JC and Cho JH.
Journal Nature 491 (7422), 119-124 (2012)
Title Mesenchymal stem cells overexpressing GCP-2 improve heart function through enhanced angiogenic properties in a myocardial infarction model .
Author Kim SW, Lee DW, Yu LH, Zhang HZ, Kim CE, Kim JM, Park TH, Cha KS, Seo SY, Roh MS, Lee KC, Jung JS and Kim MH.
Journal Cardiovasc. Res. 95 (4), 495-506 (2012)
Title Isotypic neutralizing antibodies against mouse GCP-2/CXCL6 inhibit melanoma growth and metastasis .
Author Verbeke H, Struyf S, Berghmans N, Van Coillie E, Opdenakker G, Uyttenhove C, Van Snick J and Van Damme J.
Journal Cancer Lett. 302 (1), 54-62 (2011)
Title Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility 'hot-spot' .
Author Johnatty SE, Beesley J, Chen X, Macgregor S, Duffy DL, Spurdle AB, deFazio A, Gava N, Webb PM, Rossing MA, Doherty JA, Goodman MT, Lurie G, Thompson PJ, Wilkens LR, Ness RB, Moysich KB, Chang-Claude J, Wang-Gohrke S, Cramer DW, Terry KL, Hankinson SE, Tworoger SS, Garcia-Closas M, Yang H, Lissowska J, Chanock SJ, Pharoah PD, Song H, Whitemore AS, Pearce CL, Stram DO, Wu AH, Pike MC, Gayther SA, Ramus SJ, Menon U, Gentry-Maharaj A, Anton-Culver H, Ziogas A, Hogdall E, Kjaer SK, Hogdall C, Berchuck A, Schildkraut JM, Iversen ES, Moorman PG, Phelan CM, Sellers TA, Cunningham JM, Vierkant RA, Rider DN, Goode EL, Haviv I and Chenevix-Trench G.
Journal PLoS Genet. 6 (7), E1001016 (2010)
Title Localization of the human CXC chemokine subfamily on the long arm of chromosome 4 using radiation hybrids .
Author Modi WS and Chen ZQ.
Journal Genomics 47 (1), 136-139 (1998)
Title Cloning and characterization of the human granulocyte chemotactic protein-2 gene .
Author Rovai LE, Herschman HR and Smith JB.
Journal J. Immunol. 158 (11), 5257-5266 (1997)
Title Cloning, bacterial expression and biological characterization of recombinant human granulocyte chemotactic protein-2 and differential expression of granulocyte chemotactic protein-2 and epithelial cell-derived neutrophil activating peptide-78 mRNAs .
Author Froyen G, Proost P, Ronsse I, Mitera T, Haelens A, Wuyts A, Opdenakker G, Van Damme J and Billiau A.
Journal Eur. J. Biochem. 243 (3), 762-769 (1997)
Title Human and bovine granulocyte chemotactic protein-2: complete amino acid sequence and functional characterization as chemokines .
Author Proost P, Wuyts A, Conings R, Lenaerts JP, Billiau A, Opdenakker G and Van Damme J.
Journal Biochemistry 32 (38), 10170-10177 (1993)
Title Identification of a novel granulocyte chemotactic protein (GCP-2) from human tumor cells. In vitro and in vivo comparison with natural forms of GRO, IP-10, and IL-8 .
Author Proost P, De Wolf-Peeters C, Conings R, Opdenakker G, Billiau A and Van Damme J.
Journal J. Immunol. 150 (3), 1000-1010 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.