Homo sapiens chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) (CXCL6), mRNA.
| RefSeq Version | NM_002993.3, 194733730 |
| Length | 1677 bp |
| Structure | linear |
| Update Date | 24-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) (CXCL6), mRNA. |
| Product | C-X-C motif chemokine 6 |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BP204144.1, CR614096.1 and U81234.1. On Jul 31, 2008 this sequence version replaced gi:52851409. |
| RefSeq | NP_002984.1 |
| CDS | 196..540 | Exon (1) | 1..304 | Exon (2) | 1..304 | Exon (3) | 305..437 | Exon (4) | 438..521 | Exon (5) | 522..1659 |
| Translation | MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNP
KTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 209 | + | c, g | dbSNP:79064719 |
| 409 | + | a, g | dbSNP:4608774 |
| 695 | + | c, t | dbSNP:113807832 |
| 881 | + | c, t | dbSNP:73828860 |
| 955 | + | a, c | dbSNP:79466294 |
| 995 | + | c, g | dbSNP:116018952 |
| 1023..1024 | + | , at | dbSNP:35898842 |
| 1079 | + | a, g | dbSNP:60403178 |
| 1181 | + | c, t | dbSNP:16850073 |
| 1407 | + | a, g | dbSNP:76099474 |
| 1473 | + | c, t | dbSNP:1957077 |
| Gene Symbol | CXCL6 |
| Gene Synonym | CKA-3; GCP-2; GCP2; SCYB6 |
| Chromosome | 4 |
| Locus Map | 4q21 |
| All Transcripts | NM_002993 |
| Title | Isotypic neutralizing antibodies against mouse GCP-2/CXCL6 inhibit melanoma growth and metastasis . |
| Author | Verbeke,H., Struyf,S., Berghmans,N., Van Coillie,E., Opdenakker,G., Uyttenhove,C., Van Snick,J. and Van Damme,J. |
| Journal | Cancer Lett. 302 (1), 54-62 (2011) |
| Title | Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility 'hot-spot' . |
| Author | Johnatty,S.E., Beesley,J., Chen,X., Macgregor,S., Duffy,D.L., Spurdle,A.B., deFazio,A., Gava,N., Webb,P.M., Rossing,M.A., Doherty,J.A., Goodman,M.T., Lurie,G., Thompson,P.J., Wilkens,L.R., Ness,R.B., Moysich,K.B., Chang-Claude,J., Wang-Gohrke,S., Cramer,D.W., Terry,K.L., Hankinson,S.E., Tworoger,S.S., Garcia-Closas,M., Yang,H., Lissowska,J., Chanock,S.J., Pharoah,P.D., Song,H., Whitemore,A.S., Pearce,C.L., Stram,D.O., Wu,A.H., Pike,M.C., Gayther,S.A., Ramus,S.J., Menon,U., Gentry-Maharaj,A., Anton-Culver,H., Ziogas,A., Hogdall,E., Kjaer,S.K., Hogdall,C., Berchuck,A., Schildkraut,J.M., Iversen,E.S., Moorman,P.G., Phelan,C.M., Sellers,T.A., Cunningham,J.M., Vierkant,R.A., Rider,D.N., Goode,E.L., Haviv,I. and Chenevix-Trench,G. |
| Journal | PLoS Genet. 6 (7), E1001016 (2010) |
| Title | Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls . |
| Author | Schuurhof,A., Bont,L., Siezen,C.L., Hodemaekers,H., van Houwelingen,H.C., Kimman,T.G., Hoebee,B., Kimpen,J.L. and Janssen,R. |
| Journal | Pediatr. Pulmonol. 45 (6), 608-613 (2010) |
| Title | Differential cytokine regulation by NF-kappaB and AP-1 in Jurkat T-cells . |
| Author | Khalaf,H., Jass,J. and Olsson,P.E. |
| Journal | BMC Immunol. 11, 26 (2010) |
| Title | Gonadotropin-releasing hormone-regulated chemokine expression in human placentation . |
| Author | Cavanagh,P.C., Dunk,C., Pampillo,M., Szereszewski,J.M., Taylor,J.E., Kahiri,C., Han,V., Lye,S., Bhattacharya,M. and Babwah,A.V. |
| Journal | Am. J. Physiol., Cell Physiol. 297 (1), C17-C27 (2009) |
| Title | Localization of the human CXC chemokine subfamily on the long arm of chromosome 4 using radiation hybrids . |
| Author | Modi,W.S. and Chen,Z.Q. |
| Journal | Genomics 47 (1), 136-139 (1998) |
| Title | Cloning and characterization of the human granulocyte chemotactic protein-2 gene . |
| Author | Rovai,L.E., Herschman,H.R. and Smith,J.B. |
| Journal | J. Immunol. 158 (11), 5257-5266 (1997) |
| Title | Cloning, bacterial expression and biological characterization of recombinant human granulocyte chemotactic protein-2 and differential expression of granulocyte chemotactic protein-2 and epithelial cell-derived neutrophil activating peptide-78 mRNAs . |
| Author | Froyen,G., Proost,P., Ronsse,I., Mitera,T., Haelens,A., Wuyts,A., Opdenakker,G., Van Damme,J. and Billiau,A. |
| Journal | Eur. J. Biochem. 243 (3), 762-769 (1997) |
| Title | Human and bovine granulocyte chemotactic protein-2: complete amino acid sequence and functional characterization as chemokines . |
| Author | Proost,P., Wuyts,A., Conings,R., Lenaerts,J.P., Billiau,A., Opdenakker,G. and Van Damme,J. |
| Journal | Biochemistry 32 (38), 10170-10177 (1993) |
| Title | Identification of a novel granulocyte chemotactic protein (GCP-2) from human tumor cells. In vitro and in vivo comparison with natural forms of GRO, IP-10, and IL-8 . |
| Author | Proost,P., De Wolf-Peeters,C., Conings,R., Opdenakker,G., Billiau,A. and Van Damme,J. |
| Journal | J. Immunol. 150 (3), 1000-1010 (1993) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |