• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-X3-C motif) ligand 1 (CX3CL1), mRNA.


RefSeq Accession Definition Services Price Order
NM_002996 Homo sapiens chemokine (C-X3-C motif) ligand 1 (CX3CL1), mRNA. ORF Sequence $346.26
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002996.3, 54111253
Length 3304 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-X3-C motif) ligand 1 (CX3CL1), mRNA.
Product fractalkine precursor
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC001163.1. On Oct 13, 2004 this sequence version replaced gi:52851462.

RefSeq NP_002987.1
CDS 68..1261
Misc Feature(1)2..4
Misc Feature(2)2..4
Misc Feature(3)140..367
Misc Feature(4)140..367
Misc Feature(5)order(140..211,227..253,308..337)
Misc Feature(6)order(161..181,215..223,275..283)
Misc Feature(7)164..211
Misc Feature(8)164..172
Misc Feature(9)order(179..181,191..193,269..271,278..280,359..361)
Misc Feature(10)227..253
Misc Feature(11)order(245..250,299..301,314..316,338..340)
Misc Feature(12)266..280
Misc Feature(13)368..1090
Misc Feature(14)1082..1087
Misc Feature(15)1091..1153
Exon (1)1..137
Gene:CX3CL1
Gene Synonym:ABCD-3; C3Xkine; CXC3; CXC3C; fractalkine; neurotactin; NTN; NTT; SCYD1
Exon (2)138..258
Gene:CX3CL1
Gene Synonym:ABCD-3; C3Xkine; CXC3; CXC3C; fractalkine; neurotactin; NTN; NTT; SCYD1
Exon (3)259..3273
Gene:CX3CL1
Gene Synonym:ABCD-3; C3Xkine; CXC3; CXC3C; fractalkine; neurotactin; NTN; NTT; SCYD1
Translation MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGK RAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGG MDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGP VGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENA PSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSRE PVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMF TYQSLQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
26+c, tdbSNP:200444495
27+a, gdbSNP:199506606
42+a, gdbSNP:190569013
52+c, tdbSNP:201377096
75+c, tdbSNP:140854557
76+g, tdbSNP:150111366
78+c, tdbSNP:138544995
87+c, tdbSNP:199688430
88+a, gdbSNP:141505173
94+g, tdbSNP:200604856
99+a, gdbSNP:146188225
106+c, tdbSNP:201608370
148+dbSNP:
148+c, tdbSNP:138460421
157+a, gdbSNP:186406126
160+a, gdbSNP:143072671
199+c, tdbSNP:149634321
241+c, tdbSNP:148770118
251+c, gdbSNP:201831570
252+c, tdbSNP:62037084
319+dbSNP:
319+c, tdbSNP:150847141
320+a, gdbSNP:140008646
322+a, gdbSNP:2229164
338+a, cdbSNP:200050506
340+c, tdbSNP:199609608
389+g, tdbSNP:200051975
419+a, gdbSNP:201653943
422+a, gdbSNP:147669719
448+a, gdbSNP:187920849
455+a, gdbSNP:201652312
469+a, cdbSNP:74371705
486+a, cdbSNP:200354035
529+c, tdbSNP:141389026
548+a, gdbSNP:138964688
578+c, gdbSNP:149956288
582+c, tdbSNP:199869986
637+a, cdbSNP:192202449
643+c, tdbSNP:142113631
644+a, gdbSNP:200427867
647+a, gdbSNP:149081012
691+c, gdbSNP:143145386
724+a, gdbSNP:201447345
767+c, tdbSNP:138566469
771+a, cdbSNP:146218029
777+a, gdbSNP:200554957
786+c, tdbSNP:35860084
789+c, tdbSNP:137886321
790+a, gdbSNP:142404054
804+a, gdbSNP:150690781
847+a, gdbSNP:138968060
863+a, gdbSNP:149398209
882+c, tdbSNP:201467674
922+c, tdbSNP:149904106
993+a, cdbSNP:12928112
999+a, cdbSNP:12928117
1027+a, cdbSNP:139933543
1043+a, gdbSNP:143901565
1067+a, gdbSNP:148601459
1093+a, gdbSNP:145452135
1156+a, gdbSNP:147284692
1186+a, gdbSNP:41467049
1197+c, tdbSNP:144523237
1209+a, gdbSNP:202007210
1221+a, gdbSNP:199662906
1240+a, tdbSNP:200549423
1416+c, tdbSNP:116007089
1451+g, tdbSNP:4151117
1523+c, gdbSNP:41342744
1614+a, tdbSNP:113126309
1665+c, tdbSNP:147843422
1778+c, tdbSNP:141353747
1877+a, cdbSNP:70937033
2014+a, tdbSNP:145265011
2057+a, gdbSNP:181673514
2072+c, tdbSNP:147608531
2147+c, gdbSNP:41533845
2173..2174+, cdbSNP:35197397
2176+c, tdbSNP:140521964
2185+c, gdbSNP:2239350
2196+a, gdbSNP:2239351
2228+c, tdbSNP:184315910
2261+c, tdbSNP:113692868
2284..2285+, ggadbSNP:201549742
2415+c, tdbSNP:150426266
2440+c, g, tdbSNP:67090371
2493+a, cdbSNP:138151220
2505+c, tdbSNP:2239352
2506+c, tdbSNP:70937034
2594+a, cdbSNP:2239353
2753+a, gdbSNP:149125746
2773+, gdbSNP:34047449
2870+a, cdbSNP:115095473
2873+a, gdbSNP:1050812
2926+a, gdbSNP:78604892
2999+a, gdbSNP:8323
3042+a, gdbSNP:8102
3093+a, c, gdbSNP:41444650
3130..3132+, agtdbSNP:71774586
3151+a, gdbSNP:145173369
3190+c, g, tdbSNP:3177956
Gene SymbolCX3CL1
Gene SynonymABCD-3; C3Xkine; CXC3; CXC3C; fractalkine; neurotactin; NTN; NTT; SCYD1
Chromosome16
Locus Map16q13
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002996 Homo sapiens chemokine (C-X3-C motif) ligand 1 (CX3CL1), mRNA. Full Length $1156.40
ORF Sequence $346.26
Title Arterial and venous endothelia display differential functional fractalkine (CX3CL1) expression by angiotensin-II .
Author Rius,C., Piqueras,L., Gonzalez-Navarro,H., Albertos,F., Company,C., Lopez-Gines,C., Ludwig,A., Blanes,J.I., Morcillo,E.J. and Sanz,M.J.
Journal Arterioscler. Thromb. Vasc. Biol. 33 (1), 96-104 (2013)
Title Integrins alphavbeta3 and alpha4beta1 act as coreceptors for fractalkine, and the integrin-binding defective mutant of fractalkine is an antagonist of CX3CR1 .
Author Fujita,M., Takada,Y.K. and Takada,Y.
Journal J. Immunol. 189 (12), 5809-5819 (2012)
Title Hypoxia-induced endothelial CX3CL1 triggers lung smooth muscle cell phenotypic switching and proliferative expansion .
Author Zhang,J., Hu,H., Palma,N.L., Harrison,J.K., Mubarak,K.K., Carrie,R.D., Alnuaimat,H., Shen,X., Luo,D. and Patel,J.M.
Journal Am. J. Physiol. Lung Cell Mol. Physiol. 303 (10), L912-L922 (2012)
Title Fibroblast growth factor receptor 1 activation in mammary tumor cells promotes macrophage recruitment in a CX3CL1-dependent manner .
Author Reed,J.R., Stone,M.D., Beadnell,T.C., Ryu,Y., Griffin,T.J. and Schwertfeger,K.L.
Journal PLoS ONE 7 (9), E45877 (2012)
Title Fractalkine is expressed in early and advanced atherosclerotic lesions and supports monocyte recruitment via CX3CR1 .
Author Stolla,M., Pelisek,J., von Bruhl,M.L., Schafer,A., Barocke,V., Heider,P., Lorenz,M., Tirniceriu,A., Steinhart,A., Bauersachs,J., Bray,P.F., Massberg,S. and Schulz,C.
Journal PLoS ONE 7 (8), E43572 (2012)
Title Identification of CX3CR1. A chemotactic receptor for the human CX3C chemokine fractalkine and a fusion coreceptor for HIV-1 .
Author Combadiere,C., Salzwedel,K., Smith,E.D., Tiffany,H.L., Berger,E.A. and Murphy,P.M.
Journal J. Biol. Chem. 273 (37), 23799-23804 (1998)
Title Human chemokines fractalkine (SCYD1), MDC (SCYA22) and TARC (SCYA17) are clustered on chromosome 16q13 .
Author Nomiyama,H., Imai,T., Kusuda,J., Miura,R., Callen,D.F. and Yoshie,O.
Journal Cytogenet. Cell Genet. 81 (1), 10-11 (1998)
Title Identification and molecular characterization of fractalkine receptor CX3CR1, which mediates both leukocyte migration and adhesion .
Author Imai,T., Hieshima,K., Haskell,C., Baba,M., Nagira,M., Nishimura,M., Kakizaki,M., Takagi,S., Nomiyama,H., Schall,T.J. and Yoshie,O.
Journal Cell 91 (4), 521-530 (1997)
Title Neurotactin, a membrane-anchored chemokine upregulated in brain inflammation .
Author Pan,Y., Lloyd,C., Zhou,H., Dolich,S., Deeds,J., Gonzalo,J.A., Vath,J., Gosselin,M., Ma,J., Dussault,B., Woolf,E., Alperin,G., Culpepper,J., Gutierrez-Ramos,J.C. and Gearing,D.
Journal Nature 387 (6633), 611-617 (1997)
Title A new class of membrane-bound chemokine with a CX3C motif .
Author Bazan,J.F., Bacon,K.B., Hardiman,G., Wang,W., Soo,K., Rossi,D., Greaves,D.R., Zlotnik,A. and Schall,T.J.
Journal Nature 385 (6617), 640-644 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878