• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-X3-C motif) ligand 1 (CX3CL1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002996 Homo sapiens chemokine (C-X3-C motif) ligand 1 (CX3CL1), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_002996.3, 54111253
Length 3304 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-X3-C motif) ligand 1 (CX3CL1), mRNA.
Product fractalkine precursor
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC001163.1. On Oct 13, 2004 this sequence version replaced gi:52851462.

RefSeq NP_002987.1
CDS 68..1261
Misc Feature(1)2..4
Misc Feature(2)2..4
Misc Feature(3)140..367
Misc Feature(4)140..367
Misc Feature(5)order(140..211,227..253,308..337)
Misc Feature(6)order(161..181,215..223,275..283)
Misc Feature(7)164..211
Misc Feature(8)164..172
Misc Feature(9)order(179..181,191..193,269..271,278..280,359..361)
Misc Feature(10)227..253
Misc Feature(11)order(245..250,299..301,314..316,338..340)
Misc Feature(12)266..280
Misc Feature(13)368..1090
Misc Feature(14)1082..1087
Misc Feature(15)1091..1153
Exon (1)1..137
Gene:CX3CL1
Gene Synonym:ABCD-3; C3Xkine; CXC3; CXC3C; fractalkine; neurotactin; NTN; NTT; SCYD1
Exon (2)138..258
Gene:CX3CL1
Gene Synonym:ABCD-3; C3Xkine; CXC3; CXC3C; fractalkine; neurotactin; NTN; NTT; SCYD1
Exon (3)259..3273
Gene:CX3CL1
Gene Synonym:ABCD-3; C3Xkine; CXC3; CXC3C; fractalkine; neurotactin; NTN; NTT; SCYD1
Translation MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGK RAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGG MDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGP VGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENA PSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSRE PVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMF TYQSLQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
12+c, tdbSNP:374004803
26+c, tdbSNP:200444495
27+a, gdbSNP:199506606
37+c, gdbSNP:372607275
41+c, tdbSNP:375982954
42+a, gdbSNP:190569013
45+a, gdbSNP:369287265
52+c, tdbSNP:201377096
55+a, cdbSNP:372653051
75+c, tdbSNP:140854557
76+g, tdbSNP:150111366
78+c, tdbSNP:138544995
87+c, tdbSNP:199688430
88+a, gdbSNP:141505173
94+g, tdbSNP:200604856
99+a, gdbSNP:146188225
106+c, tdbSNP:201608370
128+c, tdbSNP:374258775
134+g, tdbSNP:377237713
148+dbSNP:
148+c, tdbSNP:138460421
157+a, gdbSNP:186406126
160+a, gdbSNP:143072671
165+a, gdbSNP:375526511
166+c, tdbSNP:369341760
171+c, tdbSNP:374124184
199+c, tdbSNP:149634321
237+c, tdbSNP:374788858
241+c, tdbSNP:148770118
251+c, gdbSNP:201831570
252+c, tdbSNP:62037084
319+dbSNP:
319+c, tdbSNP:150847141
320+a, gdbSNP:140008646
321+c, tdbSNP:373726471
322+a, gdbSNP:2229164
328+a, gdbSNP:373682759
338+a, cdbSNP:200050506
340+c, tdbSNP:199609608
389+g, tdbSNP:200051975
391+c, tdbSNP:375315757
418+c, tdbSNP:376350278
419+a, gdbSNP:201653943
422+a, gdbSNP:147669719
424+a, gdbSNP:367838902
448+a, gdbSNP:187920849
455+a, gdbSNP:201652312
466+c, tdbSNP:373115385
469+a, cdbSNP:74371705
471+g, tdbSNP:372792204
486+a, cdbSNP:200354035
487+a, gdbSNP:370435863
529+c, tdbSNP:141389026
544+a, gdbSNP:368032945
548+a, gdbSNP:138964688
578+c, gdbSNP:149956288
582+c, tdbSNP:199869986
606+c, tdbSNP:374854139
637+a, cdbSNP:192202449
643+c, tdbSNP:142113631
644+a, gdbSNP:200427867
647+a, gdbSNP:149081012
662+a, cdbSNP:368270552
691+c, gdbSNP:143145386
723+c, tdbSNP:371682153
724+a, gdbSNP:201447345
731+c, gdbSNP:368015205
737+a, cdbSNP:371905283
767+c, tdbSNP:138566469
771+a, cdbSNP:146218029
777+a, gdbSNP:200554957
786+c, tdbSNP:35860084
789+c, tdbSNP:137886321
790+a, gdbSNP:142404054
803+c, tdbSNP:373175260
804+a, gdbSNP:150690781
820+a, gdbSNP:376106665
847+a, gdbSNP:138968060
852+a, gdbSNP:374046759
856+a, gdbSNP:371575579
863+a, gdbSNP:149398209
882+c, tdbSNP:201467674
922+c, tdbSNP:149904106
993+a, cdbSNP:12928112
999+a, cdbSNP:12928117
1043+a, gdbSNP:143901565
1066+c, tdbSNP:374478022
1067+a, gdbSNP:148601459
1093+a, gdbSNP:145452135
1104..1105+, gdbSNP:374793486
1120+c, tdbSNP:368338566
1128+a, gdbSNP:370865675
1138+a, gdbSNP:374256527
1156+a, gdbSNP:147284692
1186+a, gdbSNP:41467049
1197+c, tdbSNP:144523237
1208+a, cdbSNP:371635469
1209+a, gdbSNP:202007210
1217+c, tdbSNP:372821062
1220+c, tdbSNP:377166131
1221+a, gdbSNP:199662906
1240+a, tdbSNP:200549423
1283+c, tdbSNP:369905552
1416+c, tdbSNP:116007089
1451+g, tdbSNP:4151117
1523+c, gdbSNP:41342744
1544+a, tdbSNP:372332123
1614+a, tdbSNP:113126309
1665+c, tdbSNP:147843422
1778+c, tdbSNP:141353747
1877+a, cdbSNP:70937033
2014+a, tdbSNP:145265011
2057+a, gdbSNP:181673514
2072+c, tdbSNP:147608531
2147+c, gdbSNP:41533845
2173..2174+, cdbSNP:35197397
2176+c, tdbSNP:140521964
2185+c, gdbSNP:2239350
2196+a, gdbSNP:2239351
2228+c, tdbSNP:184315910
2261+c, tdbSNP:113692868
2284..2285+, ggadbSNP:201549742
2289..2290+, aggdbSNP:376302702
2358+c, tdbSNP:377382852
2415+c, tdbSNP:150426266
2440+c, g, tdbSNP:67090371
2493+a, cdbSNP:138151220
2505..2506+c, tdbSNP:70937034
2505+c, tdbSNP:2239352
2582+c, tdbSNP:371139054
2594+a, cdbSNP:2239353
complement(2753)-g, adbSNP:149125746
2773+, gdbSNP:34047449
2870+a, cdbSNP:115095473
2873+a, gdbSNP:1050812
2926+a, gdbSNP:78604892
complement(2999)-g, adbSNP:8323
complement(3042)-g, adbSNP:8102
3093+a, c, gdbSNP:41444650
3151+a, gdbSNP:145173369
3190+c, g, tdbSNP:3177956
Gene SymbolCX3CL1
Gene SynonymABCD-3; C3Xkine; CXC3; CXC3C; fractalkine; neurotactin; NTN; NTT; SCYD1
Chromosome16
Locus Map16q13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002996 Homo sapiens chemokine (C-X3-C motif) ligand 1 (CX3CL1), mRNA. In-stock $418.00 $369.00 10
Title CX3CL1 and CX3CR1 expression in tertiary lymphoid structures in salivary gland infiltrates: fractalkine contribution to lymphoid neogenesis in Sjogren's syndrome .
Author Astorri E, Scrivo R, Bombardieri M, Picarelli G, Pecorella I, Porzia A, Valesini G and Priori R.
Journal Rheumatology (Oxford) 53 (4), 611-620 (2014)
Title Chemokine-chemokine receptor CCL2-CCR2 and CX3CL1-CX3CR1 axis may play a role in the aggravated inflammation in primary biliary cirrhosis .
Author Sasaki M, Miyakoshi M, Sato Y and Nakanuma Y.
Journal Dig. Dis. Sci. 59 (2), 358-364 (2014)
Title Chemokines and atherosclerosis: focus on the CX3CL1/CX3CR1 pathway .
Author Apostolakis S and Spandidos D.
Journal Acta Pharmacol. Sin. 34 (10), 1251-1256 (2013)
Title CX3CL1 expression is associated with poor outcome in breast cancer patients .
Author Tsang JY, Ni YB, Chan SK, Shao MM, Kwok YK, Chan KW, Tan PH and Tse GM.
Journal Breast Cancer Res. Treat. 140 (3), 495-504 (2013)
Title Fractalkine (CX3CL1) and its receptor CX3CR1 may contribute to increased angiogenesis in diabetic placenta .
Author Szukiewicz D, Kochanowski J, Pyzlak M, Szewczyk G, Stangret A and Mittal TK.
Journal Mediators Inflamm. 2013, 437576 (2013)
Title Identification of CX3CR1. A chemotactic receptor for the human CX3C chemokine fractalkine and a fusion coreceptor for HIV-1 .
Author Combadiere C, Salzwedel K, Smith ED, Tiffany HL, Berger EA and Murphy PM.
Journal J. Biol. Chem. 273 (37), 23799-23804 (1998)
Title Human chemokines fractalkine (SCYD1), MDC (SCYA22) and TARC (SCYA17) are clustered on chromosome 16q13 .
Author Nomiyama H, Imai T, Kusuda J, Miura R, Callen DF and Yoshie O.
Journal Cytogenet. Cell Genet. 81 (1), 10-11 (1998)
Title Identification and molecular characterization of fractalkine receptor CX3CR1, which mediates both leukocyte migration and adhesion .
Author Imai T, Hieshima K, Haskell C, Baba M, Nagira M, Nishimura M, Kakizaki M, Takagi S, Nomiyama H, Schall TJ and Yoshie O.
Journal Cell 91 (4), 521-530 (1997)
Title Neurotactin, a membrane-anchored chemokine upregulated in brain inflammation .
Author Pan Y, Lloyd C, Zhou H, Dolich S, Deeds J, Gonzalo JA, Vath J, Gosselin M, Ma J, Dussault B, Woolf E, Alperin G, Culpepper J, Gutierrez-Ramos JC and Gearing D.
Journal Nature 387 (6633), 611-617 (1997)
Title A new class of membrane-bound chemokine with a CX3C motif .
Author Bazan JF, Bacon KB, Hardiman G, Wang W, Soo K, Rossi D, Greaves DR, Zlotnik A and Schall TJ.
Journal Nature 385 (6617), 640-644 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.