• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens succinate dehydrogenase complex, subunit B, iron sulfur (Ip) (SDHB), nuclear gene encoding mitochondrial protein, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003000 Homo sapiens succinate dehydrogenase complex, subunit B, iron sulfur (Ip) (SDHB), nuclear gene encoding mitochondrial protein, mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_003000.2, 115387093
Length 1161 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens succinate dehydrogenase complex, subunit B, iron sulfur (Ip) (SDHB), nuclear gene encoding mitochondrial protein, mRNA.
Product succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial precursor
Comment

Summary: Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis. [provided by RefSeq, Jul 2008].

RefSeq NP_002991.2
CDS 152..994
Misc Feature(1)122..124
Misc Feature(2)272..967
Misc Feature(3)272..592
Exon (1)1..223
Gene:SDHB
Gene Synonym:CWS2; IP; PGL4; SDH; SDH1; SDH2; SDHIP
Exon (2)224..351
Gene:SDHB
Gene Synonym:CWS2; IP; PGL4; SDH; SDH1; SDH2; SDHIP
Exon (3)352..437
Gene:SDHB
Gene Synonym:CWS2; IP; PGL4; SDH; SDH1; SDH2; SDHIP
Exon (4)438..574
Gene:SDHB
Gene Synonym:CWS2; IP; PGL4; SDH; SDH1; SDH2; SDHIP
Exon (5)575..691
Gene:SDHB
Gene Synonym:CWS2; IP; PGL4; SDH; SDH1; SDH2; SDHIP
Exon (6)692..793
Gene:SDHB
Gene Synonym:CWS2; IP; PGL4; SDH; SDH1; SDH2; SDHIP
Exon (7)794..916
Gene:SDHB
Gene Synonym:CWS2; IP; PGL4; SDH; SDH1; SDH2; SDHIP
Exon (8)917..1153
Gene:SDHB
Gene Synonym:CWS2; IP; PGL4; SDH; SDH1; SDH2; SDHIP
Translation MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQT YEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(13)-dbSNP:
complement(13)-c, adbSNP:114522228
complement(20)-t, cdbSNP:201399804
complement(35..36)-, cdbSNP:34633163
complement(42)-t, gdbSNP:200295549
complement(73)-g, adbSNP:201830436
complement(78)-t, cdbSNP:201016499
complement(84)-t, adbSNP:200229285
complement(107)-t, cdbSNP:202039513
complement(114)-g, adbSNP:201233054
complement(115)-g, adbSNP:143031690
complement(137)-t, cdbSNP:201837175
complement(146)-g, adbSNP:2295056
complement(147)-g, adbSNP:200890535
complement(156)-g, adbSNP:199948437
complement(159)-g, cdbSNP:11203289
complement(169)-c, adbSNP:2746462
complement(172)-g, adbSNP:147815442
complement(174)-g, adbSNP:199848267
complement(175)-g, adbSNP:148738139
complement(182)-g, adbSNP:200868378
complement(183)-t, cdbSNP:111430410
complement(184)-g, adbSNP:146399542
complement(190)-t, cdbSNP:201745731
complement(201)-g, adbSNP:138979875
complement(216)-g, cdbSNP:141230910
complement(226)-dbSNP:
complement(226)-g, adbSNP:200329668
complement(230)-t, g, cdbSNP:74315369
complement(263)-g, adbSNP:202119350
complement(264)-t, cdbSNP:143058777
complement(274)-t, cdbSNP:137877851
complement(281)-t, cdbSNP:200418115
complement(287)-g, cdbSNP:74315370
complement(294)-t, adbSNP:202101384
complement(300)-t, cdbSNP:201219456
complement(309)-t, cdbSNP:34916635
complement(321)-t, cdbSNP:35962811
complement(329)-t, cdbSNP:34599281
complement(342)-t, gdbSNP:200131173
complement(359)-dbSNP:
complement(359)-t, gdbSNP:200890320
complement(373)-t, adbSNP:199678117
complement(376)-g, adbSNP:201762207
complement(415)-g, cdbSNP:41310416
complement(419)-t, cdbSNP:74315366
complement(450)-dbSNP:
complement(450)-t, cdbSNP:121917755
complement(451)-t, cdbSNP:11541235
complement(453)-g, adbSNP:74315371
complement(458)-t, cdbSNP:140178341
complement(462)-t, cdbSNP:149617829
complement(495)-c, adbSNP:200973284
complement(503)-t, cdbSNP:200021702
complement(507)-t, cdbSNP:11541234
complement(527)-t, cdbSNP:202095022
complement(530)-t, gdbSNP:201372280
complement(546)-g, c, adbSNP:74315372
complement(550)-c, adbSNP:201403014
complement(552)-t, cdbSNP:200893429
complement(554)-t, cdbSNP:201585157
569+g, tdbSNP:267607032
complement(574)-g, adbSNP:150542357
complement(598)-dbSNP:
complement(598)-c, adbSNP:200353146
complement(606)-g, adbSNP:200414835
complement(619)-g, adbSNP:199718947
complement(638)-t, cdbSNP:33927012
complement(667)-t, cdbSNP:138937650
complement(672)-g, adbSNP:200301019
complement(674)-g, cdbSNP:202203339
complement(678)-t, cdbSNP:201082445
complement(680)-g, adbSNP:149091125
complement(681)-t, cdbSNP:150437793
complement(692)-dbSNP:
complement(692)-t, cdbSNP:201385062
complement(694)-g, adbSNP:199809975
complement(695)-t, cdbSNP:201928318
complement(703)-g, adbSNP:202098600
complement(719)-t, cdbSNP:199789177
complement(720)-g, adbSNP:201900648
complement(732)-g, cdbSNP:200535030
complement(741)-g, cdbSNP:74315367
complement(757)-g, adbSNP:199653121
complement(758)-t, cdbSNP:201517260
complement(785)-t, cdbSNP:17354040
complement(789)-g, adbSNP:202014362
complement(800)-dbSNP:
complement(800)-g, adbSNP:200245469
complement(839)-g, adbSNP:138996609
complement(851)-g, adbSNP:201728852
complement(860)-g, adbSNP:186768244
complement(867)-g, adbSNP:201098090
complement(876)-g, adbSNP:74315368
complement(887)-t, cdbSNP:146800605
complement(890)-t, cdbSNP:200896502
complement(904)-t, cdbSNP:201094649
complement(912)-, gdbSNP:34309090
complement(922)-dbSNP:
complement(922)-g, cdbSNP:199714034
complement(1012)-t, cdbSNP:201588339
complement(1023)-g, adbSNP:200504954
complement(1024)-g, adbSNP:199701267
complement(1096)-t, cdbSNP:201155896
complement(1100)-t, cdbSNP:200366300
complement(1104)-g, adbSNP:201950006
complement(1113..1114)-, adbSNP:35417465
complement(1123)-t, cdbSNP:191249882
complement(1127)-g, adbSNP:111686611
complement(1137)-g, adbSNP:201524374
complement(1144)-t, cdbSNP:200374366
complement(1146)-t, gdbSNP:202218720
complement(1153)-t, cdbSNP:75557632
Gene SymbolSDHB
Gene SynonymCWS2; IP; PGL4; SDH; SDH1; SDH2; SDHIP
Chromosome1
Locus Map1p36.1-p35
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003000 Homo sapiens succinate dehydrogenase complex, subunit B, iron sulfur (Ip) (SDHB), nuclear gene encoding mitochondrial protein, mRNA. On-demand $449.00 14
Title Missense mutations in the human SDHB gene increase protein degradation without altering intrinsic enzymatic function .
Author Yang,C., Matro,J.C., Huntoon,K.M., Ye,D.Y., Huynh,T.T., Fliedner,S.M., Breza,J., Zhuang,Z. and Pacak,K.
Journal FASEB J. 26 (11), 4506-4516 (2012)
Title Loss of succinate dehydrogenase subunit B (SDHB) expression is limited to a distinctive subset of gastric wild-type gastrointestinal stromal tumours: a comprehensive genotype-phenotype correlation study .
Author Doyle,L.A., Nelson,D., Heinrich,M.C., Corless,C.L. and Hornick,J.L.
Journal Histopathology 61 (5), 801-809 (2012)
Title Somatic mutation analysis of the SDHB, SDHC, SDHD, and RET genes in the clinical assessment of sporadic and hereditary pheochromocytoma .
Author Weber,A., Hoffmann,M.M., Neumann,H.P. and Erlic,Z.
Journal Horm Cancer 3 (4), 187-192 (2012)
Title Inhibition of alpha-KG-dependent histone and DNA demethylases by fumarate and succinate that are accumulated in mutations of FH and .
Author Xiao,M., Yang,H., Xu,W., Ma,S., Lin,H., Zhu,H., Liu,L., Liu,Y., Yang,C., Xu,Y., Zhao,S., Ye,D., Xiong,Y. and Guan,K.L.
Journal Genes Dev. 26 (12), 1326-1338 (2012)
Title Prevalence and spectrum of SDHx mutations in pheochromocytoma and paraganglioma in patients from Belgium: an update .
Author Persu,A., Lannoy,N., Maiter,D., Mendola,A., Montigny,P., Oriot,P., Vinck,W., Garin,P., Hamoir,M. and Vikkula,M.
Journal Horm. Metab. Res. 44 (5), 349-353 (2012)
Title Gene mutations in the succinate dehydrogenase subunit SDHB cause susceptibility to familial pheochromocytoma and to familial paraganglioma .
Author Astuti,D., Latif,F., Dallol,A., Dahia,P.L., Douglas,F., George,E., Skoldberg,F., Husebye,E.S., Eng,C. and Maher,E.R.
Journal Am. J. Hum. Genet. 69 (1), 49-54 (2001)
Title Structural organization of the gene encoding the human iron-sulfur subunit of succinate dehydrogenase .
Author Au,H.C., Ream-Robinson,D., Bellew,L.A., Broomfield,P.L., Saghbini,M. and Scheffler,I.E.
Journal Gene 159 (2), 249-253 (1995)
Title Identification of a novel human zinc finger protein that specifically interacts with the activation domain of lentiviral Tat proteins .
Author Fridell,R.A., Harding,L.S., Bogerd,H.P. and Cullen,B.R.
Journal Virology 209 (2), 347-357 (1995)
Title Human complex II (succinate-ubiquinone oxidoreductase): cDNA cloning of iron sulfur (Ip) subunit of liver mitochondria .
Author Kita,K., Oya,H., Gennis,R.B., Ackrell,B.A. and Kasahara,M.
Journal Biochem. Biophys. Res. Commun. 166 (1), 101-108 (1990)
Title Use of the DNA polymerase chain reaction for homology probing: isolation of partial cDNA or genomic clones encoding the iron-sulfur protein of succinate dehydrogenase from several species .
Author Gould,S.J., Subramani,S. and Scheffler,I.E.
Journal Proc. Natl. Acad. Sci. U.S.A. 86 (6), 1934-1938 (1989)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.