• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 22 (organic cation/zwitterion transporter), member 4 (SLC22A4), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19646 Homo sapiens solute carrier family 22 (organic cation/zwitterion transporter), member 4 (SLC22A4), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu19646C Homo sapiens solute carrier family 22 (organic cation/zwitterion transporter), member 4 (SLC22A4), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_003059.2, 24497489
Length 1656 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 22 (organic cation/zwitterion transporter), member 4 (SLC22A4), mRNA.
Product solute carrier family 22 member 4
Comment

Summary: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is an organic cation transporter and plasma integral membrane protein containing eleven putative transmembrane domains as well as a nucleotide-binding site motif. Transport by this protein is at least partially ATP-dependent. [provided by RefSeq, Jul 2008].

RefSeq NP_003050.2
CDS 166..1821
Misc Feature(1)73..75
Misc Feature(2)199..1719
Misc Feature(3)199..1719
Misc Feature(4)226..288
Misc Feature(5)532..1689
Misc Feature(6)order(532..534,538..543,601..603,610..615,622..624,
Misc Feature(7)589..651
Misc Feature(8)679..741
Misc Feature(9)757..819
Misc Feature(10)862..924
Misc Feature(11)937..999
Misc Feature(12)1177..1239
Misc Feature(13)1279..1341
Misc Feature(14)1363..1425
Misc Feature(15)1444..1506
Misc Feature(16)1546..1608
Misc Feature(17)1624..1686
Exon (1)1..558
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (2)559..662
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (3)663..817
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (4)818..989
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (5)990..1116
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (6)1117..1211
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (7)1212..1426
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (8)1427..1609
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (9)1610..1745
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (10)1746..2192
Gene:SLC22A4
Gene Synonym:OCTN1
Translation MRDYDEVIAFLGEWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCRVPDAANLSS AWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFS QDVYLSTVVTEWNLVCEDNWKVPLTTSLFFVGVLLGSFVSGQLSDRFGRKNVLFATMAVQ TGFSFLQIFSISWEMFTVLFVIVGMGQISNYVVAFILGTEILGKSVRIIFSTLGVCTFFA VGYMLLPLFAYFIRDWRMLLLALTVPGVLCVPLWWFIPESPRWLISQRRFREAEDIIQKA AKMNNIAVPAVIFDSVEELNPLKQQKAFILDLFRTRNIAIMTIMSLLLWMLTSVGYFALS LDAPNLHGDAYLNCFLSALIEIPAYITAWLLLRTLPRRYIIAAVLFWGGGVLLFIQLVPV DYYFLSIGLVMLGKFGITSAFSMLYVFTAELYPTLVRNMAVGVTSTASRVGSIIAPYFVY LGAYNRMLPYIVMGSLTVLIGILTLFFPESLGMTLPETLEQMQKVKWFRSGKKTRDSMET EENPKVLITAF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
18+dbSNP:
18+c, gdbSNP:367688187
93+c, tdbSNP:186843819
141+a, cdbSNP:191877372
147+a, cdbSNP:199926342
156+a, tdbSNP:11568501
260+a, gdbSNP:372949734
324+a, gdbSNP:375954722
346+a, gdbSNP:189072785
504+c, tdbSNP:11568502
561+dbSNP:
561+g, tdbSNP:149111296
572+a, gdbSNP:368904414
complement(607)-g, cdbSNP:398064
615+c, tdbSNP:371185955
616+a, gdbSNP:375482214
621+c, tdbSNP:201822770
630+c, tdbSNP:11568511
631+a, gdbSNP:141478353
640+a, gdbSNP:11568509
645+c, gdbSNP:113034123
646+a, c, gdbSNP:138375296
651+a, gdbSNP:372380514
659+a, gdbSNP:11568510
670+dbSNP:
670+a, gdbSNP:371708747
687+c, gdbSNP:374839569
688+a, gdbSNP:144031153
complement(705)-g, cdbSNP:456392
710+a, gdbSNP:369071242
720+c, tdbSNP:460415
761+a, tdbSNP:147297796
771+c, tdbSNP:11568498
780+a, gdbSNP:11568500
794+a, gdbSNP:373520579
795+c, gdbSNP:143879161
799+a, gdbSNP:148604311
804+a, gdbSNP:376697042
807+a, cdbSNP:199611329
808+g, tdbSNP:369732593
842+dbSNP:
842+c, tdbSNP:201467740
844+c, tdbSNP:375988789
845+a, gdbSNP:143140136
864+a, tdbSNP:146705097
900+a, gdbSNP:146340469
922+a, gdbSNP:372778380
925+a, cdbSNP:376295543
930+c, tdbSNP:370379416
933+c, gdbSNP:368695578
954+c, gdbSNP:200918264
956+c, tdbSNP:139188733
957+a, gdbSNP:144122563
962+c, tdbSNP:199535716
963+a, gdbSNP:371002294
976+c, gdbSNP:375525577
985+c, tdbSNP:368056012
1009+dbSNP:
1009+c, tdbSNP:11568503
1067+a, cdbSNP:201521490
1082+a, gdbSNP:386572780
complement(1082)-g, adbSNP:272893
1127+dbSNP:
1127+c, tdbSNP:140888297
1128+a, cdbSNP:200185233
1130+c, ct, tdbSNP:72552719
1167+a, gdbSNP:367863918
1171+c, tdbSNP:76343123
1258+dbSNP:
1258+a, gdbSNP:150157940
1291+c, tdbSNP:191121049
1339+c, tdbSNP:372962746
1346+c, tdbSNP:201507559
complement(1347)-g, cdbSNP:272879
1348+c, gdbSNP:1050150
1350+a, gdbSNP:148936987
1357+c, tdbSNP:201371114
1398+c, gdbSNP:17852518
1443+dbSNP:
1443+a, cdbSNP:377673823
1456+a, gdbSNP:147032697
1512+c, tdbSNP:370947767
1515+a, gdbSNP:193043140
1528+c, gdbSNP:138433908
1544+c, tdbSNP:200543879
1545+a, gdbSNP:199597043
1547..1548+, gggdbSNP:373747100
1547+g, tdbSNP:202244640
1550+a, gdbSNP:4646201
1553+a, cdbSNP:200741625
1555+a, gdbSNP:143888295
1563+a, gdbSNP:201228074
1578+c, gdbSNP:12777
1608+c, tdbSNP:183075585
1609+a, gdbSNP:148341373
1636+dbSNP:
1636+a, gdbSNP:375225322
1638+c, tdbSNP:141587824
1639+a, gdbSNP:188858026
1643+c, tdbSNP:375398349
1665+c, tdbSNP:61731074
1671+a, cdbSNP:57512142
1672+c, tdbSNP:1050152
1674+a, cdbSNP:201450794
1685+, tdbSNP:72552721
1723+c, gdbSNP:201132879
1734+a, gdbSNP:146182196
1812+dbSNP:
1812+c, tdbSNP:116837840
1824+a, gdbSNP:11568508
1914+c, tdbSNP:139332157
1917+a, c, tdbSNP:148289043
2040+a, cdbSNP:143426016
2090+c, tdbSNP:371985838
2123+c, tdbSNP:112601131
Gene SymbolSLC22A4
Gene SynonymOCTN1
Chromosome5
Locus Map5q31.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003059 Homo sapiens solute carrier family 22 (organic cation/zwitterion transporter), member 4 (SLC22A4), mRNA. On-demand $219.00 7-9
NM_003059 Homo sapiens solute carrier family 22 (organic cation/zwitterion transporter), member 4 (SLC22A4), mRNA. On-demand $219.00 7-9
Title Selenoneine, a novel selenium-containing compound, mediates detoxification mechanisms against methylmercury accumulation and toxicity in zebrafish embryo .
Author Yamashita M, Yamashita Y, Suzuki T, Kani Y, Mizusawa N, Imamura S, Takemoto K, Hara T, Hossain MA, Yabu T and Touhata K.
Journal Mar. Biotechnol. 15 (5), 559-570 (2013)
Title Polymorphisms in OCTN1 and OCTN2 transporters genes are associated with prolonged time to progression in unresectable gastrointestinal stromal tumours treated with imatinib therapy .
Author Angelini S, Pantaleo MA, Ravegnini G, Zenesini C, Cavrini G, Nannini M, Fumagalli E, Palassini E, Saponara M, Di Battista M, Casali PG, Hrelia P, Cantelli-Forti G and Biasco G.
Journal Pharmacol. Res. 68 (1), 1-6 (2013)
Title Regulation by physiological cations of acetylcholine transport mediated by human OCTN1 (SLC22A4). Implications in the non-neuronal cholinergic system .
Author Pochini L, Scalise M, Galluccio M and Indiveri C.
Journal Life Sci. 91 (21-22), 1013-1016 (2012)
Title Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease .
Author Jostins L, Ripke S, Weersma RK, Duerr RH, McGovern DP, Hui KY, Lee JC, Schumm LP, Sharma Y, Anderson CA, Essers J, Mitrovic M, Ning K, Cleynen I, Theatre E, Spain SL, Raychaudhuri S, Goyette P, Wei Z, Abraham C, Achkar JP, Ahmad T, Amininejad L, Ananthakrishnan AN, Andersen V, Andrews JM, Baidoo L, Balschun T, Bampton PA, Bitton A, Boucher G, Brand S, Buning C, Cohain A, Cichon S, D'Amato M, De Jong D, Devaney KL, Dubinsky M, Edwards C, Ellinghaus D, Ferguson LR, Franchimont D, Fransen K, Gearry R, Georges M, Gieger C, Glas J, Haritunians T, Hart A, Hawkey C, Hedl M, Hu X, Karlsen TH, Kupcinskas L, Kugathasan S, Latiano A, Laukens D, Lawrance IC, Lees CW, Louis E, Mahy G, Mansfield J, Morgan AR, Mowat C, Newman W, Palmieri O, Ponsioen CY, Potocnik U, Prescott NJ, Regueiro M, Rotter JI, Russell RK, Sanderson JD, Sans M, Satsangi J, Schreiber S, Simms LA, Sventoraityte J, Targan SR, Taylor KD, Tremelling M, Verspaget HW, De Vos M, Wijmenga C, Wilson DC, Winkelmann J, Xavier RJ, Zeissig S, Zhang B, Zhang CK, Zhao H, Silverberg MS, Annese V, Hakonarson H, Brant SR, Radford-Smith G, Mathew CG, Rioux JD, Schadt EE, Daly MJ, Franke A, Parkes M, Vermeire S, Barrett JC and Cho JH.
Journal Nature 491 (7422), 119-124 (2012)
Title A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci .
Author Kenny EE, Pe'er I, Karban A, Ozelius L, Mitchell AA, Ng SM, Erazo M, Ostrer H, Abraham C, Abreu MT, Atzmon G, Barzilai N, Brant SR, Bressman S, Burns ER, Chowers Y, Clark LN, Darvasi A, Doheny D, Duerr RH, Eliakim R, Giladi N, Gregersen PK, Hakonarson H, Jones MR, Marder K, McGovern DP, Mulle J, Orr-Urtreger A, Proctor DD, Pulver A, Rotter JI, Silverberg MS, Ullman T, Warren ST, Waterman M, Zhang W, Bergman A, Mayer L, Katz S, Desnick RJ, Cho JH and Peter I.
Journal PLoS Genet. 8 (3), E1002559 (2012)
Title Transporter gene expression in lactating and nonlactating human mammary epithelial cells using real-time reverse transcription-polymerase chain reaction .
Author Alcorn J, Lu X, Moscow JA and McNamara PJ.
Journal J. Pharmacol. Exp. Ther. 303 (2), 487-496 (2002)
Title Novel membrane transporter OCTN1 mediates multispecific, bidirectional, and pH-dependent transport of organic cations .
Author Yabuuchi H, Tamai I, Nezu J, Sakamoto K, Oku A, Shimane M, Sai Y and Tsuji A.
Journal J. Pharmacol. Exp. Ther. 289 (2), 768-773 (1999)
Title Functional characteristics and membrane localization of rat multispecific organic cation transporters, OCT1 and OCT2, mediating tubular secretion of cationic drugs .
Author Urakami Y, Okuda M, Masuda S, Saito H and Inui KI.
Journal J. Pharmacol. Exp. Ther. 287 (2), 800-805 (1998)
Title Membrane localization of the electrogenic cation transporter rOCT1 in rat liver .
Author Meyer-Wentrup F, Karbach U, Gorboulev V, Arndt P and Koepsell H.
Journal Biochem. Biophys. Res. Commun. 248 (3), 673-678 (1998)
Title Cloning and characterization of a novel human pH-dependent organic cation transporter, OCTN1 .
Author Tamai I, Yabuuchi H, Nezu J, Sai Y, Oku A, Shimane M and Tsuji A.
Journal FEBS Lett. 419 (1), 107-111 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.