• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 22 (organic cation/ergothioneine transporter), member 4 (SLC22A4), mRNA.


RefSeq Accession Definition Services Price Order
NM_003059 Homo sapiens solute carrier family 22 (organic cation/ergothioneine transporter), member 4 (SLC22A4), mRNA. ORF Sequence $480.24
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_003059.2, 24497489
Length 2214 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 22 (organic cation/ergothioneine transporter), member 4 (SLC22A4), mRNA.
Product solute carrier family 22 member 4
Comment

Summary: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is an organic cation transporter and plasma integral membrane protein containing eleven putative transmembrane domains as well as a nucleotide-binding site motif. Transport by this protein is at least partially ATP-dependent. [provided by RefSeq, Jul 2008].

RefSeq NP_003050.2
CDS 166..1821
Misc Feature(1)73..75
Misc Feature(2)73..75
Misc Feature(3)199..1719
Misc Feature(4)199..1719
Misc Feature(5)226..288
Misc Feature(6)532..>999
Misc Feature(7)589..651
Misc Feature(8)679..741
Misc Feature(9)757..819
Misc Feature(10)862..924
Misc Feature(11)937..999
Misc Feature(12)1177..1239
Misc Feature(13)<1189..1689
Misc Feature(14)1279..1341
Misc Feature(15)1363..1425
Misc Feature(16)1444..1506
Misc Feature(17)1546..1608
Misc Feature(18)1624..1686
Exon (1)1..558
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (2)559..662
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (3)663..817
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (4)818..989
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (5)990..1116
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (6)1117..1211
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (7)1212..1426
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (8)1427..1609
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (9)1610..1745
Gene:SLC22A4
Gene Synonym:OCTN1
Exon (10)1746..2192
Gene:SLC22A4
Gene Synonym:OCTN1
Translation MRDYDEVIAFLGEWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCRVPDAANLSS AWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFS QDVYLSTVVTEWNLVCEDNWKVPLTTSLFFVGVLLGSFVSGQLSDRFGRKNVLFATMAVQ TGFSFLQIFSISWEMFTVLFVIVGMGQISNYVVAFILGTEILGKSVRIIFSTLGVCTFFA VGYMLLPLFAYFIRDWRMLLLALTVPGVLCVPLWWFIPESPRWLISQRRFREAEDIIQKA AKMNNIAVPAVIFDSVEELNPLKQQKAFILDLFRTRNIAIMTIMSLLLWMLTSVGYFALS LDAPNLHGDAYLNCFLSALIEIPAYITAWLLLRTLPRRYIIAAVLFWGGGVLLFIQLVPV DYYFLSIGLVMLGKFGITSAFSMLYVFTAELYPTLVRNMAVGVTSTASRVGSIIAPYFVY LGAYNRMLPYIVMGSLTVLIGILTLFFPESLGMTLPETLEQMQKVKWFRSGKKTRDSMET EENPKVLITAF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
93+c, tdbSNP:186843819
141+a, cdbSNP:191877372
147+a, cdbSNP:199926342
156+a, tdbSNP:11568501
346+a, gdbSNP:189072785
504+c, tdbSNP:11568502
561+dbSNP:
561+g, tdbSNP:149111296
579+a, cdbSNP:143239640
607+c, gdbSNP:398064
621+c, tdbSNP:201822770
630+c, tdbSNP:11568511
631+a, gdbSNP:141478353
640+a, gdbSNP:11568509
645+c, gdbSNP:113034123
646+a, c, gdbSNP:138375296
659+a, gdbSNP:11568510
688+dbSNP:
688+a, gdbSNP:144031153
705+c, gdbSNP:456392
720+c, tdbSNP:460415
761+a, tdbSNP:147297796
771+c, tdbSNP:11568498
780+a, gdbSNP:11568500
795+c, gdbSNP:143879161
799+a, gdbSNP:148604311
807+a, cdbSNP:199611329
842+dbSNP:
842+c, tdbSNP:201467740
845+a, gdbSNP:143140136
864+a, tdbSNP:146705097
900+a, gdbSNP:146340469
954+c, gdbSNP:200918264
956+c, tdbSNP:139188733
957+a, gdbSNP:144122563
962+c, tdbSNP:199535716
1009+dbSNP:
1009+c, tdbSNP:11568503
1067+a, cdbSNP:201521490
1082+a, gdbSNP:272893
1127+dbSNP:
1127+c, tdbSNP:140888297
1128+a, cdbSNP:200185233
1130+c, ct, tdbSNP:72552719
1171+c, tdbSNP:76343123
1258+dbSNP:
1258+a, gdbSNP:150157940
1291+c, tdbSNP:191121049
1346+c, tdbSNP:201507559
1347..1348+c, gdbSNP:1050150
1347+c, gdbSNP:272879
1348+c, gdbSNP:72552720
1350+a, gdbSNP:148936987
1357+c, tdbSNP:201371114
1398+c, gdbSNP:17852518
1456+dbSNP:
1456+a, gdbSNP:147032697
1515+a, gdbSNP:193043140
1528+c, gdbSNP:138433908
1544+c, tdbSNP:200543879
1545+a, gdbSNP:199597043
1547+g, tdbSNP:202244640
1550+a, gdbSNP:4646201
1553+a, cdbSNP:200741625
1555+a, gdbSNP:143888295
1563+a, gdbSNP:201228074
1578+c, gdbSNP:12777
1608+c, tdbSNP:183075585
1609+a, gdbSNP:148341373
1638+dbSNP:
1638+c, tdbSNP:141587824
1639+a, gdbSNP:188858026
1665+c, tdbSNP:61731074
1671+a, cdbSNP:57512142
1672+c, tdbSNP:1050152
1674+a, cdbSNP:201450794
1679+, tdbSNP:72552721
1723+c, gdbSNP:201132879
1734+a, gdbSNP:146182196
1812+dbSNP:
1812+c, tdbSNP:116837840
1824+a, gdbSNP:11568508
1914+c, tdbSNP:139332157
1917+a, tdbSNP:148289043
2040+a, cdbSNP:143426016
2123+c, tdbSNP:112601131
Gene SymbolSLC22A4
Gene SynonymOCTN1
Chromosome5
Locus Map5q31.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_003059 Homo sapiens solute carrier family 22 (organic cation/ergothioneine transporter), member 4 (SLC22A4), mRNA. Full Length $642.06
ORF Sequence $480.24
Title Regulation by physiological cations of acetylcholine transport mediated by human OCTN1 (SLC22A4). Implications in the non-neuronal cholinergic system .
Author Pochini,L., Scalise,M., Galluccio,M. and Indiveri,C.
Journal Life Sci. 91 (21-22), 1013-1016 (2012)
Title The ergothioneine transporter controls and indicates ergothioneine activity--a review .
Author Grundemann,D.
Journal Prev Med 54 (SUPPL), S71-S74 (2012)
Title Expression and functional analysis of intestinal organic cation/L-carnitine transporter (OCTN) in Crohn's disease .
Author Girardin,M., Dionne,S., Goyette,P., Rioux,J., Bitton,A., Elimrani,I., Charlebois,P., Qureshi,I., Levy,E. and Seidman,E.G.
Journal J Crohns Colitis 6 (2), 189-197 (2012)
Title The human OCTN1 (SLC22A4) reconstituted in liposomes catalyzes acetylcholine transport which is defective in the mutant L503F associated to the Crohn's disease .
Author Pochini,L., Scalise,M., Galluccio,M., Pani,G., Siminovitch,K.A. and Indiveri,C.
Journal Biochim. Biophys. Acta 1818 (3), 559-565 (2012)
Title A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci .
Author Kenny,E.E., Pe'er,I., Karban,A., Ozelius,L., Mitchell,A.A., Ng,S.M., Erazo,M., Ostrer,H., Abraham,C., Abreu,M.T., Atzmon,G., Barzilai,N., Brant,S.R., Bressman,S., Burns,E.R., Chowers,Y., Clark,L.N., Darvasi,A., Doheny,D., Duerr,R.H., Eliakim,R., Giladi,N., Gregersen,P.K., Hakonarson,H., Jones,M.R., Marder,K., McGovern,D.P., Mulle,J., Orr-Urtreger,A., Proctor,D.D., Pulver,A., Rotter,J.I., Silverberg,M.S., Ullman,T., Warren,S.T., Waterman,M., Zhang,W., Bergman,A., Mayer,L., Katz,S., Desnick,R.J., Cho,J.H. and Peter,I.
Journal PLoS Genet. 8 (3), E1002559 (2012)
Title Transporter gene expression in lactating and nonlactating human mammary epithelial cells using real-time reverse transcription-polymerase chain reaction .
Author Alcorn,J., Lu,X., Moscow,J.A. and McNamara,P.J.
Journal J. Pharmacol. Exp. Ther. 303 (2), 487-496 (2002)
Title Novel membrane transporter OCTN1 mediates multispecific, bidirectional, and pH-dependent transport of organic cations .
Author Yabuuchi,H., Tamai,I., Nezu,J., Sakamoto,K., Oku,A., Shimane,M., Sai,Y. and Tsuji,A.
Journal J. Pharmacol. Exp. Ther. 289 (2), 768-773 (1999)
Title Functional characteristics and membrane localization of rat multispecific organic cation transporters, OCT1 and OCT2, mediating tubular secretion of cationic drugs .
Author Urakami,Y., Okuda,M., Masuda,S., Saito,H. and Inui,K.I.
Journal J. Pharmacol. Exp. Ther. 287 (2), 800-805 (1998)
Title Membrane localization of the electrogenic cation transporter rOCT1 in rat liver .
Author Meyer-Wentrup,F., Karbach,U., Gorboulev,V., Arndt,P. and Koepsell,H.
Journal Biochem. Biophys. Res. Commun. 248 (3), 673-678 (1998)
Title Cloning and characterization of a novel human pH-dependent organic cation transporter, OCTN1 .
Author Tamai,I., Yabuuchi,H., Nezu,J., Sai,Y., Oku,A., Shimane,M. and Tsuji,A.
Journal FEBS Lett. 419 (1), 107-111 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878