• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens snail family zinc finger 2 (SNAI2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003068 Homo sapiens snail family zinc finger 2 (SNAI2), mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 10

*Business Day

Related Services

RefSeq Version NM_003068.4, 324072669
Length 2112 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens snail family zinc finger 2 (SNAI2), mRNA.
Product zinc finger protein SNAI2
Comment

Summary: This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_003059.1
CDS 176..982
Misc Feature(1)68..70
Misc Feature(2)176..235
Misc Feature(3)176..235
Misc Feature(4)<719..>949
Misc Feature(5)773..844
Misc Feature(6)854..931
Exon (1)1..254
Gene:SNAI2
Gene Synonym:SLUG; SLUGH1; SNAIL2; WS2D
Exon (2)255..800
Gene:SNAI2
Gene Synonym:SLUG; SLUGH1; SNAIL2; WS2D
Exon (3)801..2112
Gene:SNAI2
Gene Synonym:SLUG; SLUGH1; SNAIL2; WS2D
Translation MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWT TAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP HAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK YQCKNCSKTFSRMSLLHKHEESGCCVAH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(7)-dbSNP:
complement(7)-g, cdbSNP:369985957
complement(13)-t, cdbSNP:189960900
complement(17)-g, cdbSNP:139228799
complement(55)-g, adbSNP:377272066
94+a, cdbSNP:11544359
complement(145)-c, adbSNP:200867605
complement(159)-g, adbSNP:373989408
complement(167)-c, adbSNP:201920149
complement(174)-t, gdbSNP:377304702
complement(213)-g, adbSNP:149755644
complement(256)-dbSNP:
complement(256)-c, adbSNP:199919027
266+a, cdbSNP:11544360
complement(266)-t, gdbSNP:386518885
complement(321)-t, cdbSNP:79619080
complement(374)-c, adbSNP:367909953
complement(376)-g, adbSNP:376110241
complement(394)-g, adbSNP:189890133
complement(401)-g, adbSNP:199497690
complement(405)-g, adbSNP:372039867
complement(428)-t, gdbSNP:146310523
complement(432)-g, c, adbSNP:186986959
complement(516)-t, gdbSNP:200288712
complement(540)-g, adbSNP:181954619
complement(576)-t, cdbSNP:200799419
complement(602)-t, gdbSNP:201280051
complement(669)-t, cdbSNP:374589338
complement(721)-t, cdbSNP:199761990
complement(781)-t, adbSNP:370952195
complement(849)-dbSNP:
complement(849)-t, cdbSNP:141976823
complement(876)-g, adbSNP:13280993
complement(908)-t, gdbSNP:138847615
complement(915)-g, cdbSNP:376627182
complement(988)-t, cdbSNP:200224543
complement(1005)-t, cdbSNP:201161490
complement(1008)-g, adbSNP:371076039
complement(1129..1130)-, gtdbSNP:147930178
1189+a, gdbSNP:138030819
complement(1322)-c, adbSNP:78830147
complement(1454)-t, cdbSNP:191183298
complement(1461)-c, adbSNP:188287057
complement(1734)-t, adbSNP:184610100
complement(1901)-g, adbSNP:376808532
complement(2026)-t, cdbSNP:372200548
complement(2093)-c, adbSNP:192953720
Gene SymbolSNAI2
Gene SynonymSLUG; SLUGH1; SNAIL2; WS2D
Chromosome8
Locus Map8q11
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003068 Homo sapiens snail family zinc finger 2 (SNAI2), mRNA. In-stock $348.00 $299.00 10
Title Slug expression inhibits calcitriol-mediated sensitivity to radiation in colorectal cancer .
Author Findlay VJ, Moretz RE, Wang C, Vaena SG, Bandurraga SG, Ashenafi M, Marshall DT, Watson DK and Camp ER.
Journal Mol. Carcinog. 53 (SUPPL 1), E130-E139 (2014)
Title Stress-induced cellular transcription factors expressed in trigeminal ganglionic neurons stimulate the herpes simplex virus 1 ICP0 promoter .
Author Sinani D, Cordes E, Workman A, Thunuguntia P and Jones C.
Journal J. Virol. 87 (23), 13042-13047 (2013)
Title Increased expression of Slug and Vimentin as novel predictive biomarkers for lymph node metastasis and poor prognosis in colorectal cancer .
Author Toiyama Y, Yasuda H, Saigusa S, Tanaka K, Inoue Y, Goel A and Kusunoki M.
Journal Carcinogenesis 34 (11), 2548-2557 (2013)
Title MicroRNA-181a suppresses salivary adenoid cystic carcinoma metastasis by targeting MAPK-Snai2 pathway .
Author He Q, Zhou X, Li S, Jin Y, Chen Z, Chen D, Cai Y, Liu Z, Zhao T and Wang A.
Journal Biochim. Biophys. Acta 1830 (11), 5258-5266 (2013)
Title Knockdown of Slug by RNAi inhibits the proliferation and invasion of HCT116 colorectal cancer cells .
Author Qian J, Liu H, Chen W, Wen K, Lu W, Huang C and Fu Z.
Journal Mol Med Rep 8 (4), 1055-1059 (2013)
Title Human Slug is a repressor that localizes to sites of active transcription .
Author Hemavathy K, Guru SC, Harris J, Chen JD and Ip YT.
Journal Mol. Cell. Biol. 20 (14), 5087-5095 (2000)
Title SLUG, a ces-1-related zinc finger transcription factor gene with antiapoptotic activity, is a downstream target of the E2A-HLF oncoprotein .
Author Inukai T, Inoue A, Kurosawa H, Goi K, Shinjyo T, Ozawa K, Mao M, Inaba T and Look AT.
Journal Mol. Cell 4 (3), 343-352 (1999)
Title Human transcription factor SLUG: mutation analysis in patients with neural tube defects and identification of a missense mutation (D119E) in the Slug subfamily-defining region .
Author Stegmann K, Boecker J, Kosan C, Ermert A, Kunz J and Koch MC.
Journal Mutat. Res. 406 (2-4), 63-69 (1999)
Title Human SLUG gene organization, expression, and chromosome map location on 8q .
Author Cohen ME, Yin M, Paznekas WA, Schertzer M, Wood S and Jabs EW.
Journal Genomics 51 (3), 468-471 (1998)
Title The zinc-finger protein slug causes desmosome dissociation, an initial and necessary step for growth factor-induced epithelial-mesenchymal transition .
Author Savagner P, Yamada KM and Thiery JP.
Journal J. Cell Biol. 137 (6), 1403-1419 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.