• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens snail homolog 2 (Drosophila) (SNAI2), mRNA.


RefSeq Accession Definition Services Price Order
NM_003068 Homo sapiens snail homolog 2 (Drosophila) (SNAI2), mRNA. ORF Sequence $234.03
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_003068.4, 324072669
Length 2112 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens snail homolog 2 (Drosophila) (SNAI2), mRNA.
Product zinc finger protein SNAI2
Comment

Summary: This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_003059.1
CDS 176..982
Misc Feature(1)68..70
Misc Feature(2)176..235
Misc Feature(3)176..235
Misc Feature(4)773..844
Misc Feature(5)854..931
Exon (1)1..254
Gene:SNAI2
Gene Synonym:SLUG; SLUGH1; SNAIL2; WS2D
Exon (2)255..800
Gene:SNAI2
Gene Synonym:SLUG; SLUGH1; SNAIL2; WS2D
Exon (3)801..2112
Gene:SNAI2
Gene Synonym:SLUG; SLUGH1; SNAIL2; WS2D
Translation MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWT TAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP HAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK YQCKNCSKTFSRMSLLHKHEESGCCVAH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(13)-dbSNP:
complement(13)-t, cdbSNP:189960900
complement(17)-g, cdbSNP:139228799
complement(94)-c, adbSNP:11544359
complement(145)-c, adbSNP:200867605
complement(167)-c, adbSNP:201920149
complement(213)-g, adbSNP:149755644
complement(256)-dbSNP:
complement(256)-c, adbSNP:199919027
complement(266)-c, adbSNP:11544360
complement(321)-t, cdbSNP:79619080
complement(394)-g, adbSNP:189890133
complement(401)-g, adbSNP:199497690
complement(428)-t, gdbSNP:146310523
complement(432)-g, c, adbSNP:186986959
complement(516)-t, gdbSNP:200288712
complement(540)-g, adbSNP:181954619
complement(576)-t, cdbSNP:200799419
complement(602)-t, gdbSNP:201280051
complement(721)-t, cdbSNP:199761990
complement(849)-dbSNP:
complement(849)-t, cdbSNP:141976823
complement(876)-g, adbSNP:13280993
complement(908)-t, gdbSNP:138847615
complement(988)-t, cdbSNP:200224543
complement(1005)-t, cdbSNP:201161490
complement(1129..1130)-, gtdbSNP:147930178
complement(1189)-g, adbSNP:138030819
complement(1322)-c, adbSNP:78830147
complement(1454)-t, cdbSNP:191183298
complement(1461)-c, adbSNP:188287057
complement(1734)-t, adbSNP:184610100
complement(2093)-c, adbSNP:192953720
Gene SymbolSNAI2
Gene SynonymSLUG; SLUGH1; SNAIL2; WS2D
Chromosome8
Locus Map8q11
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_003068 Homo sapiens snail homolog 2 (Drosophila) (SNAI2), mRNA. Full Length $612.48
ORF Sequence $234.03
Title Integrated analyses identify a master microRNA regulatory network for the mesenchymal subtype in serous ovarian cancer .
Author Yang,D., Sun,Y., Hu,L., Zheng,H., Ji,P., Pecot,C.V., Zhao,Y., Reynolds,S., Cheng,H., Rupaimoole,R., Cogdell,D., Nykter,M., Broaddus,R., Rodriguez-Aguayo,C., Lopez-Berestein,G., Liu,J., Shmulevich,I., Sood,A.K., Chen,K. and Zhang,W.
Journal Cancer Cell 23 (2), 186-199 (2013)
Title MicroRNA-1 targets Slug and endows lung cancer A549 cells with epithelial and anti-tumorigenic properties .
Author Tominaga,E., Yuasa,K., Shimazaki,S. and Hijikata,T.
Journal Exp. Cell Res. 319 (3), 77-88 (2013)
Title A non-secretory form of FAM3B promotes invasion and metastasis of human colon cancer cells by upregulating Slug expression .
Author Li,Z., Mou,H., Wang,T., Xue,J., Deng,B., Qian,L., Zhou,Y., Gong,W., Wang,J.M., Wu,G., Zhou,C.F., Fang,J. and Le,Y.
Journal Cancer Lett. 328 (2), 278-284 (2013)
Title Elf5 inhibits the epithelial-mesenchymal transition in mammary gland development and breast cancer metastasis by transcriptionally repressing Snail2 .
Author Chakrabarti,R., Hwang,J., Andres Blanco,M., Wei,Y., Lukacisin,M., Romano,R.A., Smalley,K., Liu,S., Yang,Q., Ibrahim,T., Mercatali,L., Amadori,D., Haffty,B.G., Sinha,S. and Kang,Y.
Journal Nat. Cell Biol. 14 (11), 1212-1222 (2012)
Title Slug, twist, and E-cadherin as immunohistochemical biomarkers in meningeal tumors .
Author Nagaishi,M., Nobusawa,S., Tanaka,Y., Ikota,H., Yokoo,H. and Nakazato,Y.
Journal PLoS ONE 7 (9), E46053 (2012)
Title Human Slug is a repressor that localizes to sites of active transcription .
Author Hemavathy,K., Guru,S.C., Harris,J., Chen,J.D. and Ip,Y.T.
Journal Mol. Cell. Biol. 20 (14), 5087-5095 (2000)
Title SLUG, a ces-1-related zinc finger transcription factor gene with antiapoptotic activity, is a downstream target of the E2A-HLF oncoprotein .
Author Inukai,T., Inoue,A., Kurosawa,H., Goi,K., Shinjyo,T., Ozawa,K., Mao,M., Inaba,T. and Look,A.T.
Journal Mol. Cell 4 (3), 343-352 (1999)
Title Human transcription factor SLUG: mutation analysis in patients with neural tube defects and identification of a missense mutation (D119E) in the Slug subfamily-defining region .
Author Stegmann,K., Boecker,J., Kosan,C., Ermert,A., Kunz,J. and Koch,M.C.
Journal Mutat. Res. 406 (2-4), 63-69 (1999)
Title Human SLUG gene organization, expression, and chromosome map location on 8q .
Author Cohen,M.E., Yin,M., Paznekas,W.A., Schertzer,M., Wood,S. and Jabs,E.W.
Journal Genomics 51 (3), 468-471 (1998)
Title The zinc-finger protein slug causes desmosome dissociation, an initial and necessary step for growth factor-induced epithelial-mesenchymal transition .
Author Savagner,P., Yamada,K.M. and Thiery,J.P.
Journal J. Cell Biol. 137 (6), 1403-1419 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878