• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 (SMARCE1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003079 Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 (SMARCE1), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_003079.4, 45827732
Length 2425 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 (SMARCE1), mRNA.
Product SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
Comment

Summary: The protein encoded by this gene is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The encoded protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart. [provided by RefSeq, Jul 2008].

RefSeq NP_003070.3
CDS 125..1360
Misc Feature(1)113..115
Misc Feature(2)113..115
Misc Feature(3)332..517
Misc Feature(4)332..517
Misc Feature(5)order(332..337,341..346,353..358,365..367,377..379,
Misc Feature(6)917..919
Exon (1)1..79
Gene:SMARCE1
Gene Synonym:BAF57
Exon (2)80..131
Gene:SMARCE1
Gene Synonym:BAF57
Exon (3)132..175
Gene:SMARCE1
Gene Synonym:BAF57
Exon (4)176..280
Gene:SMARCE1
Gene Synonym:BAF57
Exon (5)281..361
Gene:SMARCE1
Gene Synonym:BAF57
Exon (6)362..493
Gene:SMARCE1
Gene Synonym:BAF57
Exon (7)494..665
Gene:SMARCE1
Gene Synonym:BAF57
Exon (8)666..838
Gene:SMARCE1
Gene Synonym:BAF57
Exon (9)839..940
Gene:SMARCE1
Gene Synonym:BAF57
Exon (10)941..1151
Gene:SMARCE1
Gene Synonym:BAF57
Exon (11)1152..2425
Gene:SMARCE1
Gene Synonym:BAF57
Translation MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIP KPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYE AEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPD DYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRK LEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQ EEREKEAAEQAERSQSSIVPEEEQAANKGEEKKDDENIPMETEETHLEETTESQQNGEEG TSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(45)-dbSNP:
complement(45)-t, cdbSNP:141077617
complement(181)-dbSNP:
complement(181)-c, adbSNP:142279746
complement(259)-t, cdbSNP:148373393
complement(260)-g, adbSNP:11548762
complement(298)-dbSNP:
complement(298)-t, cdbSNP:201976136
complement(307)-t, gdbSNP:12103928
complement(341)-g, adbSNP:62066644
complement(424)-dbSNP:
complement(424)-t, adbSNP:143363725
complement(475)-g, adbSNP:149613910
complement(536)-dbSNP:
complement(536)-t, cdbSNP:138247204
complement(566)-g, adbSNP:147065057
complement(611)-g, adbSNP:190432371
complement(703)-dbSNP:
complement(703)-g, adbSNP:201484943
complement(717)-t, cdbSNP:75329866
complement(766)-g, adbSNP:186493032
complement(809)-g, adbSNP:141619224
complement(820)-t, cdbSNP:2293417
complement(971)-dbSNP:
complement(971)-g, cdbSNP:147883949
complement(984)-g, cdbSNP:201158885
complement(1000)-t, cdbSNP:188037270
complement(1057)-g, adbSNP:141470385
complement(1062)-t, cdbSNP:201577008
complement(1079)-t, cdbSNP:140414666
complement(1191)-dbSNP:
complement(1191)-t, cdbSNP:151220618
complement(1203)-t, cdbSNP:142193069
complement(1225)-t, cdbSNP:148666451
complement(1234)-t, cdbSNP:146475742
complement(1246)-g, adbSNP:144057094
complement(1343)-c, adbSNP:139178605
complement(1355)-c, adbSNP:62622817
complement(1470)-g, adbSNP:757412
complement(1801)-t, cdbSNP:139568831
complement(1864)-g, adbSNP:113506872
complement(1871)-t, adbSNP:188405051
complement(1932)-t, cdbSNP:150549976
complement(2068..2069)-, tdbSNP:71656646
complement(2102)-g, adbSNP:182837376
complement(2215)-t, cdbSNP:142876327
complement(2373)-t, cdbSNP:191521736
Gene SymbolSMARCE1
Gene SynonymBAF57
Chromosome17
Locus Map17q21.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003079 Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 (SMARCE1), mRNA. In-stock $418.00 $369.00 10
Title Loss-of-function mutations in SMARCE1 cause an inherited disorder of multiple spinal meningiomas .
Author Smith,M.J., O'Sullivan,J., Bhaskar,S.S., Hadfield,K.D., Poke,G., Caird,J., Sharif,S., Eccles,D., Fitzpatrick,D., Rawluk,D., du Plessis,D., Newman,W.G. and Evans,D.G.
Journal Nat. Genet. 45 (3), 295-298 (2013)
Title Prognostic significance of BAF57 expression in patients with endometrial carcinoma .
Author Kagami,S., Kurita,T., Kawagoe,T., Toki,N., Matsuura,Y., Hachisuga,T., Matsuyama,A., Hashimoto,H., Izumi,H. and Kohno,K.
Journal Histol. Histopathol. 27 (5), 593-599 (2012)
Title Identification and characterization of novel potentially oncogenic mutations in the human BAF57 gene in a breast cancer patient .
Author Villaronga,M.A., Lopez-Mateo,I., Markert,L., Espinosa,E., Fresno Vara,J.A. and Belandia,B.
Journal Breast Cancer Res. Treat. 128 (3), 891-898 (2011)
Title Ubiquitin-dependent and ubiquitin-independent control of subunit stoichiometry in the SWI/SNF complex .
Author Keppler,B.R. and Archer,T.K.
Journal J. Biol. Chem. 285 (46), 35665-35674 (2010)
Title A role for BAF57 in cell cycle-dependent transcriptional regulation by the SWI/SNF chromatin remodeling complex .
Author Hah,N., Kolkman,A., Ruhl,D.D., Pijnappel,W.W., Heck,A.J., Timmers,H.T. and Kraus,W.L.
Journal Cancer Res. 70 (11), 4402-4411 (2010)
Title The human SWI/SNF-B chromatin-remodeling complex is related to yeast rsc and localizes at kinetochores of mitotic chromosomes .
Author Xue,Y., Canman,J.C., Lee,C.S., Nie,Z., Yang,D., Moreno,G.T., Young,M.K., Salmon,E.D. and Wang,W.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (24), 13015-13020 (2000)
Title Reconstitution of a core chromatin remodeling complex from SWI/SNF subunits .
Author Phelan,M.L., Sif,S., Narlikar,G.J. and Kingston,R.E.
Journal Mol. Cell 3 (2), 247-253 (1999)
Title Architectural DNA binding by a high-mobility-group/kinesin-like subunit in mammalian SWI/SNF-related complexes .
Author Wang,W., Chi,T., Xue,Y., Zhou,S., Kuo,A. and Crabtree,G.R.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (2), 492-498 (1998)
Title Purification and biochemical heterogeneity of the mammalian SWI-SNF complex .
Author Wang,W., Cote,J., Xue,Y., Zhou,S., Khavari,P.A., Biggar,S.R., Muchardt,C., Kalpana,G.V., Goff,S.P., Yaniv,M., Workman,J.L. and Crabtree,G.R.
Journal EMBO J. 15 (19), 5370-5382 (1996)
Title Diversity and specialization of mammalian SWI/SNF complexes .
Author Wang,W., Xue,Y., Zhou,S., Kuo,A., Cairns,B.R. and Crabtree,G.R.
Journal Genes Dev. 10 (17), 2117-2130 (1996)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.