• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens serine peptidase inhibitor, Kazal type 1 (SPINK1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003122 Homo sapiens serine peptidase inhibitor, Kazal type 1 (SPINK1), mRNA. GenEZ ORF Cloning In-stock $248.00 $199.00 10

*Business Day

Related Services

RefSeq Version NM_003122.3, 195234783
Length 454 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens serine peptidase inhibitor, Kazal type 1 (SPINK1), mRNA.
Product pancreatic secretory trypsin inhibitor precursor
Comment

Summary: The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis. [provided by RefSeq, Oct 2008].

RefSeq NP_003113.2
CDS 121..360
Misc Feature(1)73..75
Misc Feature(2)223..357
Misc Feature(3)241..246
Misc Feature(4)241..246
Misc Feature(5)241..243
Exon (1)1..175
Gene:SPINK1
Gene Synonym:PCTT; PSTI; Spink3; TATI; TCP
Exon (2)176..207
Gene:SPINK1
Gene Synonym:PCTT; PSTI; Spink3; TATI; TCP
Exon (3)208..314
Gene:SPINK1
Gene Synonym:PCTT; PSTI; Spink3; TATI; TCP
Exon (4)315..441
Gene:SPINK1
Gene Synonym:PCTT; PSTI; Spink3; TATI; TCP
Translation MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVL CFENRKRQTSILIQKSGPC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(39)-dbSNP:
complement(39)-t, cdbSNP:6865184
complement(78)-t, cdbSNP:185818957
complement(79)-g, adbSNP:181484530
complement(80)-t, cdbSNP:79438751
complement(99)-g, adbSNP:190219062
complement(106)-g, adbSNP:148434824
complement(122)-t, cdbSNP:104893938
complement(125)-t, cdbSNP:145448373
complement(128)-g, adbSNP:140026715
complement(147)-, cdbSNP:193922659
complement(153)-g, adbSNP:147454311
complement(156)-g, cdbSNP:35877720
complement(161)-t, g, cdbSNP:104893939
complement(195)-dbSNP:
complement(195)-t, cdbSNP:35006579
complement(221)-dbSNP:
complement(221)-g, adbSNP:17107315
complement(230)-t, cdbSNP:200142833
complement(283)-g, c, adbSNP:111966833
complement(294)-t, cdbSNP:35737774
complement(312)-g, adbSNP:146199407
complement(314)-t, cdbSNP:141634296
complement(318)-dbSNP:
complement(318)-t, gdbSNP:143014431
complement(320)-g, adbSNP:35523678
complement(338)-g, adbSNP:200263045
complement(351)-g, adbSNP:34809998
complement(363)-g, adbSNP:1804247
complement(392)-t, cdbSNP:11319
complement(411)-g, adbSNP:113527737
complement(440)-t, g, cdbSNP:112657606
complement(441)-t, g, cdbSNP:113677347
Gene SymbolSPINK1
Gene SynonymPCTT; PSTI; Spink3; TATI; TCP
Chromosome5
Locus Map5q32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003122 Homo sapiens serine peptidase inhibitor, Kazal type 1 (SPINK1), mRNA. In-stock $248.00 $199.00 10
Title Screening of R122H and N29I mutations in the PRSS1 gene and N34S mutation in the SPINK1 gene in Mexican pediatric patients with acute and recurrent pancreatitis .
Author Sanchez-Ramirez,C.A., Flores-Martinez,S.E., Garcia-Zapien,A.G., Montero-Cruz,S.A., Larrosa-Haro,A. and Sanchez-Corona,J.
Journal Pancreas 41 (5), 707-711 (2012)
Title Functional analysis of eight missense mutations in the SPINK1 gene .
Author Boulling,A., Keiles,S., Masson,E., Chen,J.M. and Ferec,C.
Journal Pancreas 41 (2), 329-330 (2012)
Title The N34S mutation of the SPINK1 gene and alcoholic chronic pancreatitis .
Author Cichoz-Lach,H., Michalak,M., Lis,E., Wojcierowski,J., Kowalik,A., Slomka,M. and Korolczuk,A.
Journal Pol. Arch. Med. Wewn. 122 (6), 277-283 (2012)
Title Tumour-associated trypsin inhibitor TATI is a prognostic marker in colorectal cancer .
Author Koskensalo,S., Hagstrom,J., Louhimo,J., Stenman,U.H. and Haglund,C.
Journal Oncology 82 (4), 234-241 (2012)
Title [Pancreatic secretory trypsin inhibitor gene N34S mutation in patients with idiopathic chronic pancreatitis] .
Author Kucheriavyi,Iu.A., Petrova,N.V., Tibilova,Z.F., Smirnov,A.V., Oganesian,T.S., Kaziulin,A.N. and Maev,I.V.
Journal Eksp Klin Gastroenterol 7, 7-12 (2011)
Title Three-dimensional structure of a recombinant variant of human pancreatic secretory trypsin inhibitor (Kazal type) .
Author Hecht,H.J., Szardenings,M., Collins,J. and Schomburg,D.
Journal J. Mol. Biol. 225 (4), 1095-1103 (1992)
Title Interactions of pancreatic secretory trypsin inhibitor in small intestinal juice: its hydrolysis and protection by intraluminal factors .
Author Freeman,T.C., Davies,R. and Calam,J.
Journal Clin. Chim. Acta 195 (1-2), 27-39 (1990)
Title A low-molecular-mass Kazal-type protease inhibitor isolated from rat hepatocytes is identical to rat pancreatic secretory trypsin inhibitor II. Purification and amino acid sequence .
Author Kido,H., Yokogoshi,Y. and Katunuma,N.
Journal Eur. J. Biochem. 188 (3), 501-506 (1990)
Title Expression of pancreatic secretory trypsin inhibitor gene in neoplastic tissues .
Author Tomita,N., Horii,A., Yamamoto,T., Ogawa,M., Mori,T. and Matsubara,K.
Journal FEBS Lett. 225 (1-2), 113-119 (1987)
Title The primary structure of the human pancreatic secretory trypsin inhibitor. Amino acid sequence of the reduced S-aminoethylated protein .
Author Bartelt,D.C., Shapanka,R. and Greene,L.J.
Journal Arch. Biochem. Biophys. 179 (1), 189-199 (1977)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.