• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens serine peptidase inhibitor, Kazal type 1 (SPINK1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu28321 Homo sapiens serine peptidase inhibitor, Kazal type 1 (SPINK1), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu28321C Homo sapiens serine peptidase inhibitor, Kazal type 1 (SPINK1), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_003122.4, 657940887
Length 240 bp
Structure linear
Update Date 21-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens serine peptidase inhibitor, Kazal type 1 (SPINK1), mRNA.
Product pancreatic secretory trypsin inhibitor precursor
Comment

Summary: The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis. [provided by RefSeq, Oct 2008].

RefSeq NP_003113.2
CDS 290..529
Misc Feature(1)242..244
Misc Feature(2)242..244
Misc Feature(3)392..526
Misc Feature(4)410..415
Misc Feature(5)410..415
Misc Feature(6)410..412
Translation MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVL CFENRKRQTSILIQKSGPC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolSPINK1
Gene SynonymPCTT; PSTI; Spink3; TATI; TCP
Chromosome5
Locus Map5q32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003122 Homo sapiens serine peptidase inhibitor, Kazal type 1 (SPINK1), mRNA. In-stock $99.00 5-7
Title Assessment of the tumor-associated trypsin inhibitor (TATI) marker in patients with carcinoma of the uterine body 17 years after treatment .
Author Kozakiewicz,B., Chadzynska,M. and Dmoch-Gajzlerska,E.
Journal Eur. J. Gynaecol. Oncol. 35 (1), 39-43 (2014)
Title The relationship between serum tumor-associated trypsin inhibitor levels and clinicopathological parameters in patients with gastric cancer .
Author Kemik O, Kemik A, Sumer A, Almali N, Gurluler E, Gures N, Purisa S, Adas G, Dogan Y and Tuzun S.
Journal Eur Rev Med Pharmacol Sci 17 (21), 2923-2928 (2013)
Title Childhood-onset hereditary pancreatitis with mutations in the CT gene and SPINK1 gene .
Author Awano H, Lee T, Yagi M, Masamune A, Kume K, Takeshima Y and Iijima K.
Journal Pediatr Int 55 (5), 646-649 (2013)
Title Cyst fluid SPINK1 may help to differentiate benign and potentially malignant cystic pancreatic lesions .
Author Raty S, Sand J, Laukkarinen J, Vasama K, Bassi C, Salvia R and Nordback I.
Journal Pancreatology 13 (5), 530-533 (2013)
Title Upstream open reading frames cause widespread reduction of protein expression and are polymorphic among humans .
Author Calvo SE, Pagliarini DJ and Mootha VK.
Journal Proc. Natl. Acad. Sci. U.S.A. 106 (18), 7507-7512 (2009)
Title Mutations in the gene encoding the serine protease inhibitor, Kazal type 1 are associated with chronic pancreatitis .
Author Witt H, Luck W, Hennies HC, Classen M, Kage A, Lass U, Landt O and Becker M.
Journal Nat. Genet. 25 (2), 213-216 (2000)
Title Pancreatitis Overview .
Author LaRusch,J., Solomon,S. and Whitcomb,D.C.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Three-dimensional structure of a recombinant variant of human pancreatic secretory trypsin inhibitor (Kazal type) .
Author Hecht HJ, Szardenings M, Collins J and Schomburg D.
Journal J. Mol. Biol. 225 (4), 1095-1103 (1992)
Title Interactions of pancreatic secretory trypsin inhibitor in small intestinal juice: its hydrolysis and protection by intraluminal factors .
Author Freeman TC, Davies R and Calam J.
Journal Clin. Chim. Acta 195 (1-2), 27-39 (1990)
Title The primary structure of the human pancreatic secretory trypsin inhibitor. Amino acid sequence of the reduced S-aminoethylated protein .
Author Bartelt,D.C., Shapanka,R. and Greene,L.J.
Journal Arch. Biochem. Biophys. 179 (1), 189-199 (1977)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.