• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens spectrin, alpha, erythrocytic 1 (elliptocytosis 2) (SPTA1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003126 Homo sapiens spectrin, alpha, erythrocytic 1 (elliptocytosis 2) (SPTA1), mRNA. GenEZ ORF Cloning On-demand $3749.00 35

*Business Day

Related Services

RefSeq Version NM_003126.2, 115298658
Length 8017 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens spectrin, alpha, erythrocytic 1 (elliptocytosis 2) (SPTA1), mRNA.
Product spectrin alpha chain, erythrocytic 1
Comment

Summary: Spectrin is an actin crosslinking and molecular scaffold protein that links the plasma membrane to the actin cytoskeleton, and functions in the determination of cell shape, arrangement of transmembrane proteins, and organization of organelles. It is a tetramer made up of alpha-beta dimers linked in a head-to-head arrangement. This gene is one member of a family of alpha-spectrin genes. The encoded protein is primarily composed of 22 spectrin repeats which are involved in dimer formation. It forms weaker tetramer interactions than non-erythrocytic alpha spectrin, which may increase the plasma membrane elasticity and deformability of red blood cells. Mutations in this gene result in a variety of hereditary red blood cell disorders, including elliptocytosis type 2, pyropoikilocytosis, and spherocytic hemolytic anemia. [provided by RefSeq, Jul 2008].

RefSeq NP_003117.2
CDS 200..7459
Misc Feature(1)1
Misc Feature(2)1
Misc Feature(3)47..49
Misc Feature(4)254..352
Misc Feature(5)254..352
Misc Feature(6)<260..595
Misc Feature(7)353..370
Misc Feature(8)356..667
Misc Feature(9)671..985
Misc Feature(10)674..1309
Misc Feature(11)986..1003
Misc Feature(12)989..1303
Misc Feature(13)995..1627
Misc Feature(14)1304..1321
Misc Feature(15)1307..1621
Misc Feature(16)1625..1939
Misc Feature(17)1628..2260
Misc Feature(18)1940..1957
Misc Feature(19)1943..2254
Misc Feature(20)1961..2554
Misc Feature(21)2255..2272
Misc Feature(22)2258..2572
Misc Feature(23)2261..2890
Misc Feature(24)2573..2590
Misc Feature(25)2576..2890
Misc Feature(26)2894..3103
Misc Feature(27)2903..>3076
Misc Feature(28)3143..3298
Misc Feature(29)order(3155..3157,3161..3163,3170..3172,3182..3184,
Misc Feature(30)3443..3742
Misc Feature(31)3443..3736
Misc Feature(32)3746..4060
Misc Feature(33)3755..4384
Misc Feature(34)4061..4078
Misc Feature(35)4064..4378
Misc Feature(36)4382..4693
Misc Feature(37)4385..5017
Misc Feature(38)4694..4711
Misc Feature(39)4697..5014
Misc Feature(40)5018..5332
Misc Feature(41)5021..5656
Misc Feature(42)5327..5329
Misc Feature(43)5333..5350
Misc Feature(44)5336..5650
Misc Feature(45)5342..5977
Misc Feature(46)5651..5668
Misc Feature(47)5654..5977
Misc Feature(48)5981..6298
Misc Feature(49)5981..6283
Misc Feature(50)6326..6640
Misc Feature(51)6338..6979
Misc Feature(52)6665..6682
Misc Feature(53)6668..6973
Misc Feature(54)7022..7228
Misc Feature(55)order(7049..7051,7055..7057,7061..7063,7082..7084,
Misc Feature(56)7247..7453
Exon (1)1..223
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (2)224..463
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (3)464..589
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (4)590..730
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (5)731..877
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (6)878..1011
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (7)1012..1156
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (8)1157..1311
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (9)1312..1447
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (10)1448..1549
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (11)1550..1687
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (12)1688..1798
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (13)1799..1876
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (14)1877..2032
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (15)2033..2237
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (16)2238..2419
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (17)2420..2663
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (18)2664..2786
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (19)2787..3004
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (20)3005..3097
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (21)3098..3235
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (22)3236..3387
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (23)3388..3574
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (24)3575..3676
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (25)3677..3768
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (26)3769..3913
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (27)3914..4095
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (28)4096..4195
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (29)4196..4393
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (30)4394..4537
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (31)4538..4641
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (32)4642..4804
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (33)4805..4936
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (34)4937..5074
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (35)5075..5179
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (36)5180..5388
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (37)5389..5509
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (38)5510..5631
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (39)5632..5764
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (40)5765..5863
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (41)5864..6032
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (42)6033..6109
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (43)6110..6319
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (44)6320..6616
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (45)6617..6729
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (46)6730..6747
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (47)6748..6799
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (48)6800..6987
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (49)6988..7041
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (50)7042..7188
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (51)7189..7333
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (52)7334..8017
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Translation MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKR DADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFT MGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRALKFQQYVQECADILEWIGDKEAI ATSVELGEDWERTEVLHKKFEDFQVELVAKEGRVVEVNQYANECAEENHPDLPLIQSKQN EVNAAWERLRGLALQRQKALSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASE GLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDLVSSWEHIRALAT SRYEKLQATYWYHRFSSDFDELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEID SYDDRFQSADETGQDLVNANHEASDEVREKMEILDNNWTALLELWDERHRQYEQCLDFHL FYRDSEQVDSWMSRQEAFLENEDLGNSLGSAEALLQKHEDFEEAFTAQEEKIITVDKTAT KLIGDDHYDSENIKAIRDGLLARRDALREKAATRRRLLKESLLLQKLYEDSDDLKNWINK KKKLADDEDYKDIQNLKSRVQKQQVFEKELAVNKTQLENIQKTGQEMIEGGHYASDNVTT RLSEVASLWEELLEATKQKGTQLHEANQQLQFENNAEDLQRWLEDVEWQVTSEDYGKGLA EVQNRLRKHGLLESAVAARQDQVDILTDLAAYFEEIGHPDSKDIRARQESLVCRFEALKE PLATRKKKLLDLLHLQLICRDTEDEEAWIQETEPSATSTYLGKDLIASKKLLNRHRVILE NIASHEPRIQEITERGNKMVEEGHFAAEDVASRVKSLNQNMESLRARAARRQNDLEANVQ FQQYLADLHEAETWIREKEPIVDNTNYGADEEAAGALLKKHEAFLLDLNSFGDSMKALRN QANACQQQQAAPVEGVAGEQRVMALYDFQARSPREVTMKKGDVLTLLSSINKDWWKVEAA DHQGIVPAVYVRRLAHDEFPMLPQRRREEPGNITQRQEQIENQYRSLLDRAEERRRRLLQ RYNEFLLAYEAGDMLEWIQEKKAENTGVELDDVWELQKKFDEFQKDLNTNEPRLRDINKV ADDLLFEGLLTPEGAQIRQELNSRWGSLQRLADEQRQLLGSAHAVEVFHREADDTKEQIE KKCQALSAADPGSDLFSVQALQRRHEGFERDLVPLGDKVTILGETAERLSESHPDATEDL QRQKMELNEAWEDLQGRTKDRKESLNEAQKFYLFLSKARDLQNWISSIGGMVSSQELAED LTGIEILLERHQEHRADMEAEAPTFQALEDFSAELIDSGHHASPEIEKKLQAVKLERDDL EKAWEKRKKILDQCLELQMFQGNCDQVESWMVARENSLRSDDKSSLDSLEALMKKRDDLD KAITAQEGKITDLEHFAESLIADEHYAKEEIATRLQRVLDRWKALKAQLIDERTKLGDYA NLKQFYRDLEELEEWISEMLPTACDESYKDATNIQRKYLKHQTFAHEVDGRSEQVHGVIN LGNSLIECSACDGNEEAMKEQLEQLKEHWDHLLERTNDKGKKLNEASRQQRFNTSIRDFE FWLSEAETLLAMKDQARDLASAGNLLKKHQLLEREMLAREDALKDLNTLAEDLLSSGTFN VDQIVKKKDNVNKRFLNVQELAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQD YGRDLQGVQNLLKKHKRLEGELVAHEPAIQNVLDMAEKLKDKAAVGQEEIQLRLAQFVEH WEKLKELAKARGLKLEESLEYLQFMQNAEEEEAWINEKNALAVRGDCGDTLAATQSLLMK HEALENDFAVHETRVQNVCAQGEDILNKVLQEESQNKEISSKIEALNEKTPSLAKAIAAW KLQLEDDYAFQEFNWKADVVEAWIADKETSLKTNGNGADLGDFLTLLAKQDTLDASLQSF QQERLPEITDLKDKLISAQHNQSKAIEERYAALLKRWEQLLEASAVHRQKLLEKQLPLQK AEDLFVEFAHKASALNNWCEKMEENLSEPVHCVSLNEIRQLQKDHEDFLASLARAQADFK CLLELDQQIKALGVPSSPYTWLTVEVLERTWKHLSDIIEEREQELQKEEARQVKNFEMCQ EFEQNASTFLQWILETRAYFLDGSLLKETGTLESQLEANKRKQKEIQAMKRQLTKIVDLG DNLEDALILDIKYSTIGLAQQWDQLYQLGLRMQHNLEQQIQAKDIKGVSEETLKEFSTIY KHFDENLTGRLTHKEFRSCLRGLNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYT AFLIDKESENIKSSDEIENAFQALAEGKSYITKEDMKQALTPEQVSFCATHMQQYMDPRG RSHLSGYDYVGFTNSYFGN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(53)-g, adbSNP:146375927
complement(62)-c, adbSNP:187654461
complement(63..64)-, c, adbSNP:34783066
complement(63)-c, adbSNP:185621042
complement(73..74)-, adbSNP:71849621
complement(74..75)-, a, gadbSNP:59027997
complement(74)-t, cdbSNP:201226811
complement(140..141)-, gagadbSNP:60465109
complement(140)-t, cdbSNP:200804863
complement(155..156)-, gagadbSNP:67127075
complement(158..159)-, agagdbSNP:72020964
complement(159..160)-, agagdbSNP:111674514
complement(161)-t, adbSNP:200790617
complement(224)-dbSNP:
complement(224)-c, adbSNP:111321033
complement(232)-g, cdbSNP:41273533
complement(233)-t, cdbSNP:141813438
complement(246)-t, adbSNP:201634881
complement(253)-t, cdbSNP:199690643
complement(281)-t, c, adbSNP:121918642
complement(282)-t, g, adbSNP:121918641
complement(299)-g, adbSNP:201568233
complement(320)-t, c, adbSNP:121918640
complement(325)-g, adbSNP:435080
complement(334)-t, gdbSNP:121918637
complement(336)-t, gdbSNP:121918638
complement(342)-g, adbSNP:121918644
complement(344)-t, cdbSNP:121918639
complement(373)-g, adbSNP:190704778
complement(391)-t, adbSNP:200860772
complement(405)-g, adbSNP:41273531
complement(423)-g, adbSNP:146993090
complement(438)-t, cdbSNP:186235809
complement(445)-t, cdbSNP:201695052
complement(525)-dbSNP:
complement(525)-t, g, adbSNP:3737521
complement(544)-t, cdbSNP:200343758
complement(572)-t, cdbSNP:201771255
complement(580)-t, cdbSNP:199927411
complement(590)-dbSNP:
complement(590)-t, cdbSNP:199500418
complement(599)-t, cdbSNP:111885024
complement(600)-t, cdbSNP:191151467
complement(609)-t, cdbSNP:200716254
complement(640)-g, adbSNP:73020287
complement(651)-t, cdbSNP:199725919
complement(653)-t, cdbSNP:16840544
complement(819)-dbSNP:
complement(819)-t, cdbSNP:121918643
complement(878)-dbSNP:
complement(878)-t, cdbSNP:199598260
complement(920)-t, cdbSNP:199935386
complement(942)-t, cdbSNP:201424292
complement(947)-g, adbSNP:143459302
complement(963)-t, cdbSNP:201115611
complement(974)-t, cdbSNP:187932146
complement(978)-t, cdbSNP:121918634
complement(980)-t, cdbSNP:121918636
complement(992)-t, cdbSNP:183647059
complement(997)-g, adbSNP:36058424
complement(1052)-dbSNP:
complement(1052)-t, gdbSNP:150007668
complement(1066)-g, adbSNP:12083637
complement(1075)-g, adbSNP:181976789
complement(1110)-t, gdbSNP:186828067
complement(1114)-g, adbSNP:703121
complement(1141)-t, adbSNP:325996
complement(1153)-g, adbSNP:139325333
complement(1228)-dbSNP:
complement(1228)-t, cdbSNP:200641483
complement(1268)-c, adbSNP:200281735
complement(1277)-t, adbSNP:34133563
complement(1284)-t, cdbSNP:201026759
complement(1287)-t, cdbSNP:188840804
complement(1380)-dbSNP:
complement(1380)-t, cdbSNP:111834376
complement(1387)-t, adbSNP:201486521
complement(1411)-c, adbSNP:200605336
complement(1416)-t, cdbSNP:182687739
complement(1508)-dbSNP:
complement(1508)-t, cdbSNP:147677656
complement(1529)-c, adbSNP:202138403
complement(1541)-g, adbSNP:199930162
complement(1543)-t, cdbSNP:202088261
complement(1595)-dbSNP:
complement(1595)-g, cdbSNP:201669174
complement(1611)-c, adbSNP:121918635
complement(1616)-g, cdbSNP:140555949
complement(1688)-dbSNP:
complement(1688)-c, adbSNP:200722082
complement(1689)-t, gdbSNP:199604294
complement(1732)-g, adbSNP:34446973
complement(1770)-g, adbSNP:184260027
complement(1771)-t, gdbSNP:41273525
complement(1783)-t, cdbSNP:201951760
complement(1797)-g, adbSNP:201913251
complement(1840)-dbSNP:
complement(1840)-t, cdbSNP:35932551
complement(1868)-g, adbSNP:143816549
complement(1871)-t, cdbSNP:200529208
complement(1874)-t, cdbSNP:199638352
complement(1879)-dbSNP:
complement(1879)-g, cdbSNP:73020251
complement(1887)-t, cdbSNP:202243588
complement(1901)-g, adbSNP:201395636
complement(1902)-t, cdbSNP:200829664
complement(1910)-g, cdbSNP:76670910
complement(1930)-t, gdbSNP:34211240
complement(1939)-t, cdbSNP:188262107
complement(2016)-t, cdbSNP:149441716
complement(2147)-dbSNP:
complement(2147)-t, cdbSNP:201176207
complement(2157)-t, cdbSNP:148912436
complement(2181)-t, cdbSNP:201845149
complement(2219)-g, cdbSNP:201806839
complement(2272)-dbSNP:
complement(2272)-t, gdbSNP:200589641
complement(2300)-g, adbSNP:201048261
complement(2301)-t, cdbSNP:12090314
complement(2359)-g, adbSNP:199815523
complement(2381)-t, cdbSNP:200438116
complement(2414)-g, adbSNP:199544164
complement(2415)-t, cdbSNP:145972324
complement(2466)-dbSNP:
complement(2466)-g, adbSNP:118088187
complement(2495)-t, cdbSNP:11265047
complement(2552)-t, gdbSNP:2022057
complement(2572)-t, gdbSNP:7418956
complement(2603)-t, cdbSNP:201479322
complement(2617)-g, adbSNP:35318623
complement(2624)-t, cdbSNP:7547313
complement(2671)-dbSNP:
complement(2671)-t, cdbSNP:35856400
complement(2692)-c, adbSNP:2518493
complement(2705)-t, cdbSNP:201844450
complement(2719)-g, cdbSNP:34577746
complement(2722)-t, gdbSNP:184137546
complement(2757)-g, cdbSNP:35121052
complement(2780)-g, cdbSNP:192979264
complement(2799)-dbSNP:
complement(2799)-t, gdbSNP:115877891
complement(2807)-t, cdbSNP:140291959
complement(2847)-g, adbSNP:139771435
complement(2852)-g, adbSNP:147573740
complement(2864)-c, adbSNP:200293444
complement(2871)-g, adbSNP:36057043
complement(2879)-c, adbSNP:201184588
complement(2894)-c, adbSNP:145647381
complement(2902)-g, adbSNP:144579942
complement(2956)-t, cdbSNP:16840450
complement(3011)-dbSNP:
complement(3011)-g, cdbSNP:36109350
complement(3061)-g, adbSNP:183996341
complement(3069)-t, cdbSNP:34706737
complement(3073)-t, cdbSNP:857691
complement(3108)-dbSNP:
complement(3108)-c, adbSNP:35948326
complement(3113)-g, cdbSNP:148064417
complement(3218)-g, adbSNP:201324641
complement(3261)-dbSNP:
complement(3261)-t, adbSNP:200511900
complement(3265)-g, adbSNP:200825021
complement(3272)-t, cdbSNP:199503178
complement(3307)-t, cdbSNP:34886778
complement(3308)-t, cdbSNP:201519091
complement(3319)-t, cdbSNP:200809766
complement(3333)-t, cdbSNP:202042176
complement(3348)-g, adbSNP:116297260
complement(3359)-t, adbSNP:145054175
complement(3366)-c, adbSNP:188875641
complement(3370)-g, adbSNP:35078963
complement(3429)-dbSNP:
complement(3429)-t, cdbSNP:199612744
complement(3513)-t, gdbSNP:200193956
complement(3533)-c, adbSNP:142379038
complement(3538)-g, adbSNP:148769994
complement(3556)-g, cdbSNP:200230894
complement(3575)-dbSNP:
complement(3575)-t, cdbSNP:146014855
complement(3588)-t, cdbSNP:202016242
complement(3597)-g, cdbSNP:35733059
complement(3599)-t, gdbSNP:12754252
complement(3636)-g, adbSNP:200143693
complement(3686)-dbSNP:
complement(3686)-c, adbSNP:2482965
complement(3747)-t, gdbSNP:182461140
complement(3788)-dbSNP:
complement(3788)-g, cdbSNP:200985856
complement(3807)-t, cdbSNP:201615192
complement(3821)-t, cdbSNP:180925766
complement(3867)-t, cdbSNP:148714399
complement(3892)-t, cdbSNP:34773716
complement(3941)-dbSNP:
complement(3941)-g, adbSNP:200714808
complement(4028)-g, adbSNP:143642542
complement(4029)-t, cdbSNP:201407861
complement(4038)-t, cdbSNP:200890386
complement(4040)-g, adbSNP:199685020
complement(4131)-dbSNP:
complement(4131)-g, adbSNP:200961682
complement(4139)-g, adbSNP:200308788
complement(4159)-g, adbSNP:186415745
complement(4165)-c, adbSNP:181634584
complement(4188)-t, gdbSNP:34214405
complement(4236)-dbSNP:
complement(4236)-t, gdbSNP:188328804
complement(4249)-g, adbSNP:201829580
complement(4296)-g, adbSNP:199585380
complement(4439)-dbSNP:
complement(4439)-g, adbSNP:201399968
complement(4501)-t, cdbSNP:77182042
complement(4510)-g, adbSNP:189877287
complement(4591)-dbSNP:
complement(4591)-t, cdbSNP:200749925
complement(4617)-g, adbSNP:187916559
complement(4628)-g, adbSNP:201961961
complement(4652)-dbSNP:
complement(4652)-t, cdbSNP:34973695
complement(4670)-t, cdbSNP:183260145
complement(4676)-t, cdbSNP:35237700
complement(4689)-t, cdbSNP:41273523
complement(4763)-t, cdbSNP:201910178
complement(4790)-g, cdbSNP:143779235
complement(4875)-dbSNP:
complement(4875)-g, adbSNP:201663225
complement(4889)-t, adbSNP:201336751
complement(4893)-t, adbSNP:202217097
complement(4901)-g, adbSNP:863931
complement(4910)-c, adbSNP:201601992
complement(4911)-t, cdbSNP:199899448
complement(4932)-t, adbSNP:200648256
complement(5010)-dbSNP:
complement(5010)-t, cdbSNP:201151453
complement(5032)-t, cdbSNP:145288947
complement(5093)-dbSNP:
complement(5093)-t, cdbSNP:200283499
complement(5276)-dbSNP:
complement(5276)-t, gdbSNP:857725
complement(5280)-t, cdbSNP:201822255
complement(5292)-g, adbSNP:182430449
complement(5301)-t, adbSNP:200748323
complement(5317)-g, adbSNP:200945419
complement(5395)-dbSNP:
complement(5395)-g, cdbSNP:201286670
complement(5455)-t, cdbSNP:141683960
complement(5491)-c, adbSNP:3738791
complement(5529)-dbSNP:
complement(5529)-t, cdbSNP:183540526
complement(5550)-g, adbSNP:113693504
complement(5577)-t, cdbSNP:200938874
complement(5587)-t, cdbSNP:61140046
complement(5591)-c, adbSNP:189782613
complement(5594)-c, adbSNP:185420305
complement(5609)-g, adbSNP:116959874
complement(5656)-dbSNP:
complement(5656)-t, cdbSNP:186994154
complement(5706)-t, cdbSNP:16830483
complement(5749)-t, cdbSNP:138263468
complement(5771)-dbSNP:
complement(5771)-g, cdbSNP:3737515
complement(5820)-t, cdbSNP:201233455
complement(5900)-dbSNP:
complement(5900)-g, adbSNP:202192320
complement(5977)-g, adbSNP:146520285
complement(5978)-t, cdbSNP:200317311
complement(5985)-g, cdbSNP:199547344
complement(6027)-c, adbSNP:181469626
complement(6029)-t, cdbSNP:190413073
complement(6037)-dbSNP:
complement(6037)-g, adbSNP:200330662
complement(6110)-dbSNP:
complement(6110)-t, cdbSNP:116466258
complement(6114)-t, gdbSNP:201463616
complement(6128)-g, cdbSNP:201133139
complement(6142)-t, cdbSNP:139443888
complement(6157)-g, adbSNP:3753068
complement(6178)-t, gdbSNP:192628102
complement(6191)-g, cdbSNP:77877855
complement(6225)-t, cdbSNP:188580757
complement(6233)-t, cdbSNP:78325016
complement(6245)-g, adbSNP:78394850
complement(6246)-t, cdbSNP:199993378
complement(6311)-g, adbSNP:75931146
complement(6331)-dbSNP:
complement(6331)-g, cdbSNP:186987240
complement(6335)-t, cdbSNP:202105292
complement(6427)-t, adbSNP:191322728
complement(6516)-t, adbSNP:138806173
complement(6542)-g, adbSNP:145017824
complement(6558)-g, cdbSNP:182897201
complement(6571..6572)-, cdbSNP:34647363
complement(6577)-t, cdbSNP:141823269
complement(6620)-dbSNP:
complement(6620)-g, adbSNP:41273519
complement(6621)-t, cdbSNP:201838571
complement(6636)-t, cdbSNP:138055271
complement(6651)-t, cdbSNP:202169454
complement(6653)-t, gdbSNP:207460485
complement(6732)-dbSNP:
complement(6732)-g, adbSNP:115466520
complement(6743)-g, cdbSNP:187749998
complement(6758)-dbSNP:
complement(6758)-t, cdbSNP:111980420
complement(6808)-dbSNP:
complement(6808)-c, adbSNP:79592002
complement(6871)-t, gdbSNP:142775522
complement(6874)-g, adbSNP:186647435
complement(6926)-t, cdbSNP:181147022
complement(6993)-dbSNP:
complement(6993)-g, adbSNP:952094
complement(7048)-dbSNP:
complement(7048)-g, adbSNP:200868381
complement(7049)-t, cdbSNP:138732899
complement(7095)-c, adbSNP:201514157
complement(7126)-c, adbSNP:201801824
complement(7231)-dbSNP:
complement(7231)-t, adbSNP:150057853
complement(7259)-t, cdbSNP:140630986
complement(7267)-t, gdbSNP:78598639
complement(7294)-t, cdbSNP:2251969
complement(7303)-c, adbSNP:112884419
complement(7343)-dbSNP:
complement(7343)-g, adbSNP:199554383
complement(7382)-g, adbSNP:144692310
complement(7399)-g, adbSNP:201438753
complement(7426)-g, adbSNP:200990199
complement(7460)-g, adbSNP:200530620
complement(7498)-t, cdbSNP:202171095
complement(7527)-g, cdbSNP:186892978
complement(7556..7557)-, ac, acacacacacdbSNP:55832242
complement(7589..7590)-, gtdbSNP:68118007
complement(7590..7591)-, cadbSNP:66981873
complement(7626)-g, adbSNP:3768535
complement(7735)-g, adbSNP:12128275
complement(7754)-t, cdbSNP:12601
complement(7959)-, adbSNP:34122435
complement(7990)-t, cdbSNP:183671800
Gene SymbolSPTA1
Gene SynonymEL2; HPP; HS3; SPH3; SPTA
Chromosome1
Locus Map1q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003126 Homo sapiens spectrin, alpha, erythrocytic 1 (elliptocytosis 2) (SPTA1), mRNA. On-demand $3749.00 35
Title Identification of a conserved aggregation-prone intermediate state in the folding pathways of Spc-SH3 amyloidogenic variants .
Author Krobath,H., Estacio,S.G., Faisca,P.F. and Shakhnovich,E.I.
Journal J. Mol. Biol. 422 (5), 705-722 (2012)
Title Enterohaemorrhagic Escherichia coli requires the spectrin cytoskeleton for efficient attachment and pedestal formation on host cells .
Author Ruetz,T.J., Lin,A.E. and Guttman,J.A.
Journal Microb. Pathog. 52 (3), 149-156 (2012)
Title [Spectrin--variety of functions hidden in the structure] .
Author Wolny,M., Wroblewska,A.M., Machnicka,B. and Sikorski,A.F.
Journal Postepy Biochem. 58 (3), 245-254 (2012)
Title Apparent structural differences at the tetramerization region of erythroid and nonerythroid beta spectrin as discriminated by phage displayed scFvs .
Author Song,Y., Antoniou,C., Memic,A., Kay,B.K. and Fung,L.W.
Journal Protein Sci. 20 (5), 867-879 (2011)
Title Glycosylation of erythrocyte spectrin and its modification in visceral leishmaniasis .
Author Samanta,S., Dutta,D., Ghoshal,A., Mukhopadhyay,S., Saha,B., Sundar,S., Jarmalavicius,S., Forgber,M., Mandal,C., Walden,P. and Mandal,C.
Journal PLoS ONE 6 (12), E28169 (2011)
Title A deletional frameshift mutation of the beta-spectrin gene associated with elliptocytosis in spectrin Tokyo (beta 220/216) .
Author Kanzaki,A., Rabodonirina,M., Yawata,Y., Wilmotte,R., Wada,H., Ata,K., Yamada,O., Akatsuka,J., Iyori,H., Horiguchi,M. et al.
Journal Blood 80 (8), 2115-2121 (1992)
Title Properties of human red cell spectrin heterodimer (side-to-side) assembly and identification of an essential nucleation site .
Author Speicher,D.W., Weglarz,L. and DeSilva,T.M.
Journal J. Biol. Chem. 267 (21), 14775-14782 (1992)
Title Dinucleotide repeat polymorphism at the human erythroid alpha spectrin (SPTA1) locus .
Author Hentati,A., Hu,P., Asgharzadeh,S. and Siddique,T.
Journal Hum. Mol. Genet. 1 (3), 218 (1992)
Title A common type of the spectrin alpha I 46-50a-kD peptide abnormality in hereditary elliptocytosis and pyropoikilocytosis is associated with a mutation distant from the proteolytic cleavage site. Evidence for the functional importance of the triple helical model of spectrin .
Author Gallagher,P.G., Tse,W.T., Coetzer,T., Lecomte,M.C., Garbarz,M., Zarkowsky,H.S., Baruchel,A., Ballas,S.K., Dhermy,D., Palek,J. et al.
Journal J. Clin. Invest. 89 (3), 892-898 (1992)
Title The membrane attachment protein for spectrin is associated with band 3 in human erythrocyte membranes .
Author Bennett,V. and Stenbuck,P.J.
Journal Nature 280 (5722), 468-473 (1979)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.