• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens spectrin, alpha, erythrocytic 1 (SPTA1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu28487 Homo sapiens spectrin, alpha, erythrocytic 1 (SPTA1), mRNA. pcDNA3.1+-DYK On-demand $3749.00 35
OHu28487C Homo sapiens spectrin, alpha, erythrocytic 1 (SPTA1), mRNA. Customized vector On-demand $3749.00 35

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_003126.2, 115298658
Length 7260 bp
Structure linear
Update Date 25-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens spectrin, alpha, erythrocytic 1 (SPTA1), mRNA.
Product spectrin alpha chain, erythrocytic 1
Comment

Summary: Spectrin is an actin crosslinking and molecular scaffold protein that links the plasma membrane to the actin cytoskeleton, and functions in the determination of cell shape, arrangement of transmembrane proteins, and organization of organelles. It is a tetramer made up of alpha-beta dimers linked in a head-to-head arrangement. This gene is one member of a family of alpha-spectrin genes. The encoded protein is primarily composed of 22 spectrin repeats which are involved in dimer formation. It forms weaker tetramer interactions than non-erythrocytic alpha spectrin, which may increase the plasma membrane elasticity and deformability of red blood cells. Mutations in this gene result in a variety of hereditary red blood cell disorders, including elliptocytosis type 2, pyropoikilocytosis, and spherocytic hemolytic anemia. [provided by RefSeq, Jul 2008].

RefSeq NP_003117.2
CDS 200..7459
Misc Feature(1)1
Misc Feature(2)1
Misc Feature(3)47..49
Misc Feature(4)254..352
Misc Feature(5)254..352
Misc Feature(6)<260..673
Misc Feature(7)353..370
Misc Feature(8)356..667
Misc Feature(9)671..985
Misc Feature(10)674..1309
Misc Feature(11)986..1003
Misc Feature(12)989..1303
Misc Feature(13)995..1627
Misc Feature(14)1304..1321
Misc Feature(15)1307..1621
Misc Feature(16)1625..1939
Misc Feature(17)1628..2260
Misc Feature(18)1940..1957
Misc Feature(19)1943..2254
Misc Feature(20)2258..2572
Misc Feature(21)2261..2890
Misc Feature(22)2573..2590
Misc Feature(23)2576..2890
Misc Feature(24)2894..3103
Misc Feature(25)2897..3748
Misc Feature(26)3143..3298
Misc Feature(27)order(3155..3157,3161..3163,3170..3172,3182..3184,
Misc Feature(28)3440..3457
Misc Feature(29)3443..3742
Misc Feature(30)3746..4060
Misc Feature(31)3755..4384
Misc Feature(32)4061..4078
Misc Feature(33)4064..4378
Misc Feature(34)4382..4693
Misc Feature(35)4385..5017
Misc Feature(36)4694..4711
Misc Feature(37)4697..5014
Misc Feature(38)5018..5332
Misc Feature(39)5021..5656
Misc Feature(40)5327..5329
Misc Feature(41)5333..5350
Misc Feature(42)5336..5650
Misc Feature(43)5342..5977
Misc Feature(44)5651..5668
Misc Feature(45)5654..5977
Misc Feature(46)5981..6298
Misc Feature(47)5987..6643
Misc Feature(48)6302..6319
Misc Feature(49)6326..6640
Misc Feature(50)6338..6979
Misc Feature(51)6641..6658
Misc Feature(52)6668..6973
Misc Feature(53)7022..7228
Misc Feature(54)order(7049..7051,7055..7057,7061..7063,7082..7084,
Misc Feature(55)7247..7453
Exon (1)1..223
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (2)224..463
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (3)464..589
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (4)590..730
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (5)731..877
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (6)878..1011
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (7)1012..1156
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (8)1157..1311
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (9)1312..1447
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (10)1448..1549
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (11)1550..1687
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (12)1688..1798
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (13)1799..1876
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (14)1877..2032
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (15)2033..2237
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (16)2238..2419
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (17)2420..2663
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (18)2664..2786
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (19)2787..3004
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (20)3005..3097
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (21)3098..3235
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (22)3236..3387
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (23)3388..3574
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (24)3575..3676
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (25)3677..3768
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (26)3769..3913
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (27)3914..4095
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (28)4096..4195
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (29)4196..4393
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (30)4394..4537
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (31)4538..4641
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (32)4642..4804
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (33)4805..4936
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (34)4937..5074
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (35)5075..5179
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (36)5180..5388
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (37)5389..5509
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (38)5510..5631
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (39)5632..5764
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (40)5765..5863
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (41)5864..6032
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (42)6033..6109
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (43)6110..6319
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (44)6320..6616
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (45)6617..6729
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (46)6730..6747
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (47)6748..6799
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (48)6800..6987
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (49)6988..7041
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (50)7042..7188
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (51)7189..7333
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Exon (52)7334..8017
Gene:SPTA1
Gene Synonym:EL2; HPP; HS3; SPH3; SPTA
Translation MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKR DADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFT MGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRALKFQQYVQECADILEWIGDKEAI ATSVELGEDWERTEVLHKKFEDFQVELVAKEGRVVEVNQYANECAEENHPDLPLIQSKQN EVNAAWERLRGLALQRQKALSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASE GLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDLVSSWEHIRALAT SRYEKLQATYWYHRFSSDFDELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEID SYDDRFQSADETGQDLVNANHEASDEVREKMEILDNNWTALLELWDERHRQYEQCLDFHL FYRDSEQVDSWMSRQEAFLENEDLGNSLGSAEALLQKHEDFEEAFTAQEEKIITVDKTAT KLIGDDHYDSENIKAIRDGLLARRDALREKAATRRRLLKESLLLQKLYEDSDDLKNWINK KKKLADDEDYKDIQNLKSRVQKQQVFEKELAVNKTQLENIQKTGQEMIEGGHYASDNVTT RLSEVASLWEELLEATKQKGTQLHEANQQLQFENNAEDLQRWLEDVEWQVTSEDYGKGLA EVQNRLRKHGLLESAVAARQDQVDILTDLAAYFEEIGHPDSKDIRARQESLVCRFEALKE PLATRKKKLLDLLHLQLICRDTEDEEAWIQETEPSATSTYLGKDLIASKKLLNRHRVILE NIASHEPRIQEITERGNKMVEEGHFAAEDVASRVKSLNQNMESLRARAARRQNDLEANVQ FQQYLADLHEAETWIREKEPIVDNTNYGADEEAAGALLKKHEAFLLDLNSFGDSMKALRN QANACQQQQAAPVEGVAGEQRVMALYDFQARSPREVTMKKGDVLTLLSSINKDWWKVEAA DHQGIVPAVYVRRLAHDEFPMLPQRRREEPGNITQRQEQIENQYRSLLDRAEERRRRLLQ RYNEFLLAYEAGDMLEWIQEKKAENTGVELDDVWELQKKFDEFQKDLNTNEPRLRDINKV ADDLLFEGLLTPEGAQIRQELNSRWGSLQRLADEQRQLLGSAHAVEVFHREADDTKEQIE KKCQALSAADPGSDLFSVQALQRRHEGFERDLVPLGDKVTILGETAERLSESHPDATEDL QRQKMELNEAWEDLQGRTKDRKESLNEAQKFYLFLSKARDLQNWISSIGGMVSSQELAED LTGIEILLERHQEHRADMEAEAPTFQALEDFSAELIDSGHHASPEIEKKLQAVKLERDDL EKAWEKRKKILDQCLELQMFQGNCDQVESWMVARENSLRSDDKSSLDSLEALMKKRDDLD KAITAQEGKITDLEHFAESLIADEHYAKEEIATRLQRVLDRWKALKAQLIDERTKLGDYA NLKQFYRDLEELEEWISEMLPTACDESYKDATNIQRKYLKHQTFAHEVDGRSEQVHGVIN LGNSLIECSACDGNEEAMKEQLEQLKEHWDHLLERTNDKGKKLNEASRQQRFNTSIRDFE FWLSEAETLLAMKDQARDLASAGNLLKKHQLLEREMLAREDALKDLNTLAEDLLSSGTFN VDQIVKKKDNVNKRFLNVQELAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQD YGRDLQGVQNLLKKHKRLEGELVAHEPAIQNVLDMAEKLKDKAAVGQEEIQLRLAQFVEH WEKLKELAKARGLKLEESLEYLQFMQNAEEEEAWINEKNALAVRGDCGDTLAATQSLLMK HEALENDFAVHETRVQNVCAQGEDILNKVLQEESQNKEISSKIEALNEKTPSLAKAIAAW KLQLEDDYAFQEFNWKADVVEAWIADKETSLKTNGNGADLGDFLTLLAKQDTLDASLQSF QQERLPEITDLKDKLISAQHNQSKAIEERYAALLKRWEQLLEASAVHRQKLLEKQLPLQK AEDLFVEFAHKASALNNWCEKMEENLSEPVHCVSLNEIRQLQKDHEDFLASLARAQADFK CLLELDQQIKALGVPSSPYTWLTVEVLERTWKHLSDIIEEREQELQKEEARQVKNFEMCQ EFEQNASTFLQWILETRAYFLDGSLLKETGTLESQLEANKRKQKEIQAMKRQLTKIVDLG DNLEDALILDIKYSTIGLAQQWDQLYQLGLRMQHNLEQQIQAKDIKGVSEETLKEFSTIY KHFDENLTGRLTHKEFRSCLRGLNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYT AFLIDKESENIKSSDEIENAFQALAEGKSYITKEDMKQALTPEQVSFCATHMQQYMDPRG RSHLSGYDYVGFTNSYFGN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(53)-g, adbSNP:146375927
62+a, cdbSNP:187654461
complement(63..64)-, c, adbSNP:34783066
63+a, cdbSNP:185621042
complement(64..65)-, adbSNP:374043072
complement(67..68)-, adbSNP:386368443
complement(69..70)-, adbSNP:386368442
complement(73..74)-, adbSNP:368011566
complement(74..75)-, a, gadbSNP:59027997
complement(74)-t, cdbSNP:201226811
complement(79..80)-, gdbSNP:368830436
complement(140..141)-, gagadbSNP:60465109
complement(140..141)-, gagadbSNP:397780243
140+c, tdbSNP:200804863
complement(151..152)-, gagadbSNP:386368441
complement(158..159)-, agagdbSNP:72020964
complement(159..160)-, agagdbSNP:111674514
complement(161)-t, adbSNP:200790617
complement(223)-t, gdbSNP:377733228
complement(224)-dbSNP:
complement(224)-c, adbSNP:111321033
complement(232)-g, cdbSNP:41273533
complement(233)-t, cdbSNP:141813438
complement(238)-g, adbSNP:368463827
complement(246)-t, adbSNP:201634881
complement(253)-t, cdbSNP:199690643
281+a, c, tdbSNP:121918642
282+a, g, tdbSNP:121918641
complement(288)-t, cdbSNP:367992717
complement(299)-g, adbSNP:201568233
complement(313)-g, cdbSNP:370472299
320+a, c, tdbSNP:121918640
complement(325)-g, adbSNP:435080
complement(331)-g, cdbSNP:377396196
complement(333)-t, cdbSNP:374697328
334+g, tdbSNP:121918637
336+g, tdbSNP:121918638
342+a, gdbSNP:121918644
344+c, tdbSNP:121918639
complement(373)-g, adbSNP:190704778
complement(377)-g, adbSNP:373695294
complement(391)-t, adbSNP:200860772
complement(400)-t, cdbSNP:372582587
complement(405)-g, adbSNP:41273531
complement(423)-g, adbSNP:146993090
complement(429)-g, adbSNP:372828197
complement(438)-t, cdbSNP:186235809
complement(442)-g, adbSNP:369988146
complement(445)-t, cdbSNP:201695052
complement(458)-t, cdbSNP:369020363
complement(525)-dbSNP:
complement(525)-t, g, adbSNP:3737521
complement(528)-t, adbSNP:368253777
complement(544)-t, cdbSNP:200343758
complement(572)-t, cdbSNP:201771255
complement(575)-g, adbSNP:367850580
complement(580)-t, cdbSNP:199927411
complement(585)-g, adbSNP:374406059
complement(590)-dbSNP:
complement(590)-t, cdbSNP:199500418
complement(599)-t, cdbSNP:111885024
complement(600)-t, cdbSNP:191151467
complement(609)-t, cdbSNP:200716254
complement(635)-g, adbSNP:376823216
complement(640)-g, adbSNP:73020287
complement(651)-t, cdbSNP:199725919
complement(653)-t, cdbSNP:16840544
complement(665)-g, adbSNP:377051298
complement(723)-t, cdbSNP:372282702
complement(743)-dbSNP:
complement(743)-t, cdbSNP:377021666
complement(773)-g, adbSNP:371828666
complement(779)-t, cdbSNP:367689703
819+c, tdbSNP:121918643
complement(878)-dbSNP:
complement(878)-t, cdbSNP:199598260
complement(895)-t, cdbSNP:377366233
complement(909)-g, cdbSNP:374611447
complement(920)-t, cdbSNP:199935386
complement(938)-g, cdbSNP:369993070
complement(942)-t, cdbSNP:201424292
complement(947)-g, adbSNP:143459302
complement(963)-t, cdbSNP:201115611
complement(974)-t, cdbSNP:187932146
978+c, tdbSNP:121918634
980+c, tdbSNP:121918636
complement(991)-t, adbSNP:267598105
complement(992)-t, cdbSNP:183647059
complement(997)-g, adbSNP:36058424
complement(1002)-t, cdbSNP:374770233
complement(1006)-g, adbSNP:267598104
complement(1052)-dbSNP:
complement(1052)-t, gdbSNP:150007668
complement(1057)-t, cdbSNP:370463832
complement(1066)-g, adbSNP:12083637
complement(1075)-g, adbSNP:181976789
complement(1110)-t, gdbSNP:186828067
complement(1114)-g, adbSNP:703121
complement(1141)-t, adbSNP:325996
complement(1153)-g, adbSNP:139325333
complement(1170)-dbSNP:
complement(1170)-t, cdbSNP:374842824
complement(1228)-t, cdbSNP:200641483
complement(1240)-t, adbSNP:371350304
complement(1260)-t, cdbSNP:368912200
complement(1268)-c, adbSNP:200281735
complement(1277)-t, adbSNP:34133563
complement(1284)-t, cdbSNP:201026759
complement(1287)-t, cdbSNP:188840804
complement(1380)-dbSNP:
complement(1380)-t, cdbSNP:111834376
complement(1383)-g, adbSNP:375096050
complement(1387)-t, adbSNP:201486521
complement(1390)-t, cdbSNP:370445219
complement(1411)-c, adbSNP:200605336
complement(1416)-t, cdbSNP:182687739
complement(1419)-g, adbSNP:377396098
complement(1429)-g, adbSNP:375614146
complement(1465)-dbSNP:
complement(1465)-g, adbSNP:369020197
complement(1473)-c, adbSNP:374892311
complement(1494)-g, adbSNP:371700284
complement(1508)-t, cdbSNP:147677656
complement(1529)-c, adbSNP:202138403
complement(1541)-g, adbSNP:199930162
complement(1543)-t, cdbSNP:202088261
complement(1586)-dbSNP:
complement(1586)-g, cdbSNP:375491573
complement(1595)-g, cdbSNP:201669174
complement(1598)-t, cdbSNP:376169797
complement(1602)-t, cdbSNP:372937123
complement(1608)-t, cdbSNP:370498187
1611+a, cdbSNP:121918635
complement(1616)-g, cdbSNP:140555949
complement(1617)-t, adbSNP:377132919
complement(1688)-dbSNP:
complement(1688)-c, adbSNP:200722082
complement(1689)-t, gdbSNP:199604294
complement(1725)-c, adbSNP:377049823
1732+a, gdbSNP:34446973
complement(1751)-t, gdbSNP:367992735
complement(1770)-g, adbSNP:184260027
complement(1771)-t, gdbSNP:41273525
complement(1783)-t, cdbSNP:201951760
complement(1785)-t, cdbSNP:371521996
complement(1797)-g, adbSNP:201913251
complement(1817)-dbSNP:
complement(1817)-t, cdbSNP:267598103
1840+c, tdbSNP:35932551
complement(1866)-g, adbSNP:374983413
complement(1868)-g, adbSNP:143816549
complement(1871)-t, cdbSNP:200529208
complement(1874)-t, cdbSNP:199638352
complement(1879)-dbSNP:
complement(1879)-g, cdbSNP:73020251
complement(1886)-g, adbSNP:369087649
complement(1887)-t, cdbSNP:202243588
complement(1901)-g, adbSNP:201395636
complement(1902)-t, cdbSNP:200829664
complement(1910)-g, cdbSNP:76670910
complement(1930)-t, gdbSNP:34211240
complement(1931)-t, gdbSNP:374453913
complement(1939)-t, cdbSNP:188262107
complement(1943)-g, adbSNP:372049975
complement(1952)-t, gdbSNP:368469337
complement(2016)-t, cdbSNP:149441716
complement(2043)-dbSNP:
complement(2043)-t, adbSNP:376612556
complement(2099)-t, cdbSNP:377757393
complement(2101)-t, cdbSNP:374442926
complement(2110)-t, cdbSNP:375235247
complement(2119)-t, cdbSNP:369680582
complement(2147)-t, cdbSNP:201176207
complement(2156)-g, adbSNP:377311296
complement(2157)-t, cdbSNP:148912436
complement(2181)-t, cdbSNP:201845149
complement(2188)-t, adbSNP:374853565
complement(2219)-g, cdbSNP:201806839
complement(2272)-dbSNP:
complement(2272)-t, gdbSNP:200589641
complement(2290)-t, gdbSNP:375568203
complement(2298)-t, cdbSNP:372728613
complement(2300)-t, g, adbSNP:201048261
complement(2301)-t, cdbSNP:12090314
complement(2344)-g, adbSNP:371855997
complement(2359)-g, adbSNP:199815523
complement(2368)-g, cdbSNP:368012895
complement(2373)-t, cdbSNP:375230030
complement(2381)-t, cdbSNP:200438116
complement(2403)-g, adbSNP:377362395
complement(2404)-g, adbSNP:376278222
complement(2411)-g, cdbSNP:370468407
complement(2414)-g, adbSNP:199544164
complement(2415)-t, cdbSNP:145972324
complement(2466)-dbSNP:
complement(2466)-g, adbSNP:118088187
complement(2495)-t, cdbSNP:11265047
complement(2499)-t, cdbSNP:372508159
complement(2552)-t, gdbSNP:2022057
complement(2558)-t, cdbSNP:375728433
complement(2572)-t, gdbSNP:7418956
complement(2603)-t, cdbSNP:201479322
complement(2617)-g, adbSNP:35318623
complement(2624)-t, cdbSNP:7547313
complement(2636)-t, cdbSNP:367886335
complement(2671)-dbSNP:
complement(2671)-t, cdbSNP:35856400
complement(2689)-g, cdbSNP:375892683
complement(2692)-c, adbSNP:2518493
complement(2692)-c, adbSNP:386568707
complement(2705)-t, cdbSNP:201844450
complement(2717)-g, cdbSNP:376835431
complement(2719)-g, cdbSNP:34577746
2722+g, tdbSNP:184137546
complement(2727)-g, adbSNP:369695627
2757+c, gdbSNP:35121052
complement(2780)-g, cdbSNP:192979264
complement(2799)-dbSNP:
complement(2799)-t, gdbSNP:115877891
complement(2807)-t, cdbSNP:140291959
complement(2811)-g, adbSNP:375610306
complement(2847)-g, adbSNP:139771435
complement(2852)-g, adbSNP:147573740
complement(2853)-t, cdbSNP:370989483
complement(2854)-g, adbSNP:368544526
complement(2864)-c, adbSNP:200293444
2871+a, gdbSNP:36057043
complement(2879)-c, adbSNP:201184588
complement(2894)-c, adbSNP:145647381
complement(2902)-g, adbSNP:144579942
complement(2927)-t, cdbSNP:267598102
complement(2939)-g, adbSNP:370612932
complement(2956)-t, cdbSNP:16840450
complement(3011)-dbSNP:
complement(3011)-g, cdbSNP:36109350
complement(3030)-g, adbSNP:377688677
complement(3034)-t, cdbSNP:374168455
complement(3061)-g, adbSNP:183996341
complement(3069)-t, cdbSNP:34706737
complement(3073)-t, cdbSNP:857691
complement(3073)-t, cdbSNP:386436992
complement(3088)-g, adbSNP:371639635
3108+dbSNP:
3108+a, cdbSNP:35948326
complement(3113)-g, cdbSNP:148064417
complement(3167)-c, adbSNP:374897423
complement(3218)-g, adbSNP:201324641
complement(3261)-dbSNP:
complement(3261)-t, adbSNP:200511900
complement(3265)-g, adbSNP:200825021
complement(3272)-t, cdbSNP:199503178
complement(3286)-g, cdbSNP:371406234
complement(3307)-t, cdbSNP:34886778
complement(3308)-t, cdbSNP:201519091
complement(3319)-t, c, adbSNP:200809766
complement(3332)-g, adbSNP:373548086
complement(3333)-t, cdbSNP:202042176
complement(3348)-g, adbSNP:116297260
complement(3359)-t, adbSNP:145054175
complement(3366)-c, adbSNP:188875641
complement(3370)-g, adbSNP:35078963
complement(3425)-dbSNP:
complement(3425)-t, gdbSNP:372281474
complement(3429)-t, cdbSNP:199612744
complement(3513)-t, gdbSNP:200193956
complement(3533)-c, adbSNP:142379038
complement(3538)-g, adbSNP:148769994
complement(3543)-t, gdbSNP:370460517
complement(3556)-g, cdbSNP:200230894
complement(3558)-t, adbSNP:376284347
complement(3575)-dbSNP:
complement(3575)-t, cdbSNP:146014855
complement(3584)-t, cdbSNP:373158767
complement(3588)-t, cdbSNP:202016242
complement(3597)-g, cdbSNP:35733059
complement(3599)-t, gdbSNP:12754252
complement(3636)-g, adbSNP:200143693
complement(3641)-t, cdbSNP:369038187
complement(3671)-g, adbSNP:374770895
complement(3686)-dbSNP:
complement(3686)-c, adbSNP:2482965
complement(3747)-t, gdbSNP:182461140
complement(3766)-g, adbSNP:372008857
complement(3788)-dbSNP:
complement(3788)-g, cdbSNP:200985856
complement(3807)-t, cdbSNP:201615192
complement(3813)-t, gdbSNP:370881201
complement(3821)-t, cdbSNP:180925766
complement(3867)-t, cdbSNP:148714399
complement(3870)-t, cdbSNP:370505272
complement(3871)-g, cdbSNP:375828123
complement(3892)-t, cdbSNP:34773716
complement(3896)-t, cdbSNP:369125471
complement(3901)-t, gdbSNP:376004665
complement(3910)-g, adbSNP:373848368
complement(3921)-dbSNP:
complement(3921)-g, adbSNP:368004559
complement(3923)-g, adbSNP:376742422
complement(3931)-t, cdbSNP:371537374
complement(3941)-g, adbSNP:200714808
complement(3995)-g, cdbSNP:374697790
complement(4027)-t, cdbSNP:372838864
complement(4028)-g, adbSNP:143642542
complement(4028)-g, adbSNP:386467119
complement(4029)-t, cdbSNP:201407861
complement(4038)-t, cdbSNP:200890386
complement(4040)-g, adbSNP:199685020
complement(4041)-t, cdbSNP:374733516
complement(4091)-t, cdbSNP:370291171
complement(4131)-dbSNP:
complement(4131)-g, adbSNP:200961682
complement(4139)-g, adbSNP:200308788
complement(4153)-g, adbSNP:369559397
complement(4159)-g, adbSNP:186415745
complement(4165)-c, adbSNP:181634584
4188+g, tdbSNP:34214405
complement(4236)-dbSNP:
complement(4236)-t, gdbSNP:188328804
complement(4249)-g, adbSNP:201829580
complement(4296)-g, adbSNP:199585380
complement(4358)-g, adbSNP:372067263
complement(4359)-t, cdbSNP:368282292
complement(4361)-t, cdbSNP:374087076
complement(4373)-g, cdbSNP:370799608
complement(4439)-dbSNP:
complement(4439)-g, adbSNP:201399968
complement(4501)-t, cdbSNP:77182042
complement(4510)-g, adbSNP:189877287
complement(4546)-dbSNP:
complement(4546)-c, adbSNP:375506528
complement(4552)-g, adbSNP:372181965
complement(4586)-g, cdbSNP:368557666
complement(4591)-t, cdbSNP:200749925
complement(4607)-t, cdbSNP:376552785
complement(4617)-g, adbSNP:187916559
complement(4619)-g, adbSNP:368042757
complement(4628)-g, adbSNP:201961961
complement(4629)-t, cdbSNP:370469842
complement(4647)-dbSNP:
complement(4647)-t, cdbSNP:374774131
4652+c, tdbSNP:34973695
complement(4670)-t, cdbSNP:183260145
complement(4676)-t, cdbSNP:35237700
complement(4689)-t, cdbSNP:41273523
complement(4727)-t, cdbSNP:368360991
complement(4763)-t, cdbSNP:201910178
complement(4789)-g, adbSNP:372099409
complement(4790)-g, cdbSNP:143779235
complement(4807)-dbSNP:
complement(4807)-t, cdbSNP:371290853
complement(4819)-t, cdbSNP:376712487
complement(4843)-g, adbSNP:373029557
complement(4871)-t, cdbSNP:370514287
complement(4875)-g, adbSNP:201663225
complement(4887)-t, cdbSNP:375836488
complement(4889)-t, adbSNP:201336751
complement(4893)-t, adbSNP:202217097
complement(4901)-g, adbSNP:863931
complement(4910)-c, adbSNP:201601992
complement(4911)-t, cdbSNP:199899448
complement(4932)-t, adbSNP:200648256
complement(4959)-dbSNP:
complement(4959)-t, cdbSNP:367634336
complement(4963)-g, adbSNP:375629152
complement(4995)-t, cdbSNP:372347749
complement(5010)-t, cdbSNP:201151453
complement(5032)-t, cdbSNP:145288947
complement(5061)-t, adbSNP:374298000
complement(5093)-dbSNP:
complement(5093)-t, cdbSNP:200283499
complement(5118)-g, adbSNP:369714529
complement(5127)-t, cdbSNP:369900804
complement(5173)-t, adbSNP:377692942
complement(5188)-dbSNP:
complement(5188)-g, cdbSNP:369565453
complement(5219)-g, adbSNP:376908088
complement(5240)-t, cdbSNP:371655531
complement(5276)-t, gdbSNP:857725
complement(5280)-t, cdbSNP:201822255
complement(5287)-g, cdbSNP:371661849
complement(5292)-g, adbSNP:182430449
complement(5301)-t, adbSNP:200748323
complement(5302)-t, cdbSNP:368669029
complement(5317)-g, adbSNP:200945419
complement(5392)-dbSNP:
complement(5392)-t, cdbSNP:374928535
complement(5394)-t, gdbSNP:370558180
complement(5395)-g, cdbSNP:201286670
complement(5399)-t, adbSNP:370258501
complement(5400)-g, adbSNP:377763465
complement(5403)-t, cdbSNP:374379436
complement(5455)-t, cdbSNP:141683960
complement(5462)-g, adbSNP:377659326
5491+a, cdbSNP:3738791
complement(5495)-t, cdbSNP:369304211
5529+dbSNP:
5529+c, tdbSNP:183540526
complement(5550)-g, adbSNP:113693504
complement(5557)-t, cdbSNP:368542665
complement(5576)-g, adbSNP:375618954
complement(5577)-t, cdbSNP:200938874
complement(5587)-t, cdbSNP:61140046
complement(5591)-c, adbSNP:189782613
complement(5594)-c, adbSNP:185420305
complement(5605)-g, cdbSNP:374730563
complement(5609)-g, adbSNP:116959874
complement(5643)-dbSNP:
complement(5643)-g, adbSNP:367644017
complement(5656)-t, cdbSNP:186994154
complement(5692)-t, cdbSNP:371269282
complement(5706)-t, cdbSNP:16830483
complement(5726)-t, cdbSNP:373183356
complement(5730)-c, adbSNP:371114338
complement(5749)-t, cdbSNP:138263468
complement(5771)-dbSNP:
complement(5771)-g, cdbSNP:3737515
complement(5793)-t, adbSNP:372380092
complement(5809)-t, gdbSNP:369902263
complement(5815)-g, cdbSNP:376695662
complement(5818)-t, gdbSNP:372084800
complement(5820)-t, cdbSNP:201233455
complement(5842)-t, cdbSNP:375384407
complement(5852)-t, gdbSNP:372091356
complement(5878)-dbSNP:
complement(5878)-t, cdbSNP:370169350
complement(5900)-g, adbSNP:202192320
complement(5904)-t, adbSNP:368786953
complement(5977)-g, adbSNP:146520285
complement(5978)-t, cdbSNP:200317311
complement(5985)-g, cdbSNP:199547344
complement(6027)-c, adbSNP:181469626
complement(6029)-t, cdbSNP:190413073
complement(6037)-dbSNP:
complement(6037)-g, adbSNP:200330662
complement(6087)-t, adbSNP:372634442
complement(6110)-dbSNP:
complement(6110)-t, cdbSNP:116466258
complement(6112)-g, adbSNP:376799877
complement(6114)-t, gdbSNP:201463616
complement(6123)-t, gdbSNP:371752399
complement(6128)-g, cdbSNP:201133139
complement(6130)-c, adbSNP:367688778
complement(6142)-t, cdbSNP:139443888
complement(6157)-g, adbSNP:3753068
complement(6177)-t, cdbSNP:372816408
complement(6178)-t, gdbSNP:192628102
complement(6191)-g, cdbSNP:77877855
complement(6224)-g, adbSNP:374336960
complement(6225)-t, cdbSNP:188580757
complement(6233)-t, cdbSNP:78325016
complement(6235)-g, adbSNP:376057870
complement(6245)-g, adbSNP:78394850
complement(6246)-t, cdbSNP:199993378
complement(6248)-t, adbSNP:377008650
complement(6272)-t, cdbSNP:372466475
complement(6311)-g, adbSNP:75931146
complement(6331)-dbSNP:
complement(6331)-g, cdbSNP:186987240
complement(6334)-g, adbSNP:369162735
complement(6335)-t, cdbSNP:202105292
complement(6395)-g, adbSNP:371308896
complement(6409)-t, cdbSNP:368873387
complement(6410)-g, adbSNP:374496114
6427+a, tdbSNP:191322728
complement(6434)-g, adbSNP:372075053
complement(6457)-t, cdbSNP:368317545
complement(6496)-c, adbSNP:374169093
complement(6516)-t, adbSNP:138806173
complement(6520)-c, adbSNP:370757944
complement(6542)-g, adbSNP:145017824
complement(6558)-g, cdbSNP:182897201
complement(6570..6571)-, cdbSNP:34647363
complement(6577)-t, c, adbSNP:141823269
complement(6620)-dbSNP:
complement(6620)-g, adbSNP:41273519
complement(6621)-t, cdbSNP:201838571
complement(6636)-t, cdbSNP:138055271
complement(6651)-t, cdbSNP:202169454
complement(6653)-t, gdbSNP:207460485
complement(6732)-dbSNP:
complement(6732)-g, adbSNP:115466520
complement(6743)-g, cdbSNP:187749998
complement(6749)-dbSNP:
complement(6749)-g, adbSNP:367661960
complement(6758)-t, cdbSNP:111980420
complement(6808)-dbSNP:
complement(6808)-c, adbSNP:79592002
complement(6835)-t, gdbSNP:372849405
complement(6847)-t, adbSNP:369112261
complement(6855)-g, adbSNP:374751703
complement(6871)-t, gdbSNP:142775522
complement(6874)-g, adbSNP:186647435
complement(6888)-t, cdbSNP:369323191
complement(6900)-t, cdbSNP:369894033
complement(6926)-t, cdbSNP:181147022
complement(6950)-g, adbSNP:375813087
complement(6951)-t, cdbSNP:372533502
complement(6971)-t, gdbSNP:368355710
complement(6993)-dbSNP:
complement(6993)-g, adbSNP:952094
complement(7048)-dbSNP:
complement(7048)-g, adbSNP:200868381
complement(7049)-t, cdbSNP:138732899
complement(7049)-t, cdbSNP:386467220
complement(7050)-t, cdbSNP:374589766
complement(7054)-c, adbSNP:371341474
complement(7069)-t, gdbSNP:376766197
complement(7088)-g, adbSNP:375016862
complement(7095)-c, adbSNP:201514157
complement(7126)-c, adbSNP:201801824
complement(7143)-t, gdbSNP:375875276
complement(7147)-t, cdbSNP:377656082
complement(7222)-dbSNP:
complement(7222)-g, adbSNP:377572207
complement(7231)-t, adbSNP:150057853
complement(7259)-t, cdbSNP:140630986
complement(7263)-t, cdbSNP:373400656
complement(7267)-t, gdbSNP:78598639
complement(7278)-g, adbSNP:375552473
complement(7289)-g, adbSNP:267598101
complement(7294)-t, cdbSNP:2251969
complement(7303)-c, adbSNP:112884419
complement(7315)-g, cdbSNP:371499429
complement(7343)-dbSNP:
complement(7343)-g, adbSNP:199554383
complement(7382)-g, adbSNP:144692310
complement(7387)-g, cdbSNP:376052117
complement(7399)-g, adbSNP:201438753
complement(7416)-t, cdbSNP:374005409
complement(7419)-t, cdbSNP:370270782
complement(7426)-g, adbSNP:200990199
complement(7436)-t, adbSNP:376198878
complement(7446)-t, cdbSNP:372942217
complement(7458)-t, cdbSNP:369955517
complement(7460)-g, adbSNP:200530620
complement(7473)-c, adbSNP:374235146
complement(7480)-t, cdbSNP:369500677
complement(7498)-t, cdbSNP:202171095
complement(7527)-g, cdbSNP:186892978
complement(7556..7557)-, ac, acacacacacdbSNP:55832242
complement(7557..7558)-, gtdbSNP:68118007
complement(7588..7591)-, cacadbSNP:372359921
complement(7590..7591)-, cadbSNP:66981873
complement(7592..7593)-, agdbSNP:376905669
7626+a, gdbSNP:3768535
complement(7735)-g, adbSNP:12128275
7754+c, tdbSNP:12601
complement(7959)-, adbSNP:34122435
complement(7990)-t, cdbSNP:183671800
Gene SymbolSPTA1
Gene SynonymEL2; HPP; HS3; SPH3; SPTA
Chromosome1
Locus Map1q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003126 Homo sapiens spectrin, alpha, erythrocytic 1 (SPTA1), mRNA. On-demand $3749.00 35
Title The common hereditary elliptocytosis-associated alpha-spectrin L260P mutation perturbs erythrocyte membranes by stabilizing spectrin in the closed dimer conformation .
Author Harper SL, Sriswasdi S, Tang HY, Gaetani M, Gallagher PG and Speicher DW.
Journal Blood 122 (17), 3045-3053 (2013)
Title Genome wide association analysis of a founder population identified TAF3 as a gene for MCHC in humans .
Author Pistis G, Okonkwo SU, Traglia M, Sala C, Shin SY, Masciullo C, Buetti I, Massacane R, Mangino M, Thein SL, Spector TD, Ganesh S, Pirastu N, Gasparini P, Soranzo N, Camaschella C, Hart D, Green MR and Toniolo D.
Journal PLoS ONE 8 (7), E69206 (2013)
Title Seventy-five genetic loci influencing the human red blood cell .
Author van der Harst P, Zhang W, Mateo Leach I, Rendon A, Verweij N, Sehmi J, Paul DS, Elling U, Allayee H, Li X, Radhakrishnan A, Tan ST, Voss K, Weichenberger CX, Albers CA, Al-Hussani A, Asselbergs FW, Ciullo M, Danjou F, Dina C, Esko T, Evans DM, Franke L, Gogele M, Hartiala J, Hersch M, Holm H, Hottenga JJ, Kanoni S, Kleber ME, Lagou V, Langenberg C, Lopez LM, Lyytikainen LP, Melander O, Murgia F, Nolte IM, O'Reilly PF, Padmanabhan S, Parsa A, Pirastu N, Porcu E, Portas L, Prokopenko I, Ried JS, Shin SY, Tang CS, Teumer A, Traglia M, Ulivi S, Westra HJ, Yang J, Zhao JH, Anni F, Abdellaoui A, Attwood A, Balkau B, Bandinelli S, Bastardot F, Benyamin B, Boehm BO, Cookson WO, Das D, de Bakker PI, de Boer RA, de Geus EJ, de Moor MH, Dimitriou M, Domingues FS, Doring A, Engstrom G, Eyjolfsson GI, Ferrucci L, Fischer K, Galanello R, Garner SF, Genser B, Gibson QD, Girotto G, Gudbjartsson DF, Harris SE, Hartikainen AL, Hastie CE, Hedblad B, Illig T, Jolley J, Kahonen M, Kema IP, Kemp JP, Liang L, Lloyd-Jones H, Loos RJ, Meacham S, Medland SE, Meisinger C, Memari Y, Mihailov E, Miller K, Moffatt MF, Nauck M, Novatchkova M, Nutile T, Olafsson I, Onundarson PT, Parracciani D, Penninx BW, Perseu L, Piga A, Pistis G, Pouta A, Puc U, Raitakari O, Ring SM, Robino A, Ruggiero D, Ruokonen A, Saint-Pierre A, Sala C, Salumets A, Sambrook J, Schepers H, Schmidt CO, Sillje HH, Sladek R, Smit JH, Starr JM, Stephens J, Sulem P, Tanaka T, Thorsteinsdottir U, Tragante V, van Gilst WH, van Pelt LJ, van Veldhuisen DJ, Volker U, Whitfield JB, Willemsen G, Winkelmann BR, Wirnsberger G, Algra A, Cucca F, d'Adamo AP, Danesh J, Deary IJ, Dominiczak AF, Elliott P, Fortina P, Froguel P, Gasparini P, Greinacher A, Hazen SL, Jarvelin MR, Khaw KT, Lehtimaki T, Maerz W, Martin NG, Metspalu A, Mitchell BD, Montgomery GW, Moore C, Navis G, Pirastu M, Pramstaller PP, Ramirez-Solis R, Schadt E, Scott J, Shuldiner AR, Smith GD, Smith JG, Snieder H, Sorice R, Spector TD, Stefansson K, Stumvoll M, Tang WH, Toniolo D, Tonjes A, Visscher PM, Vollenweider P, Wareham NJ, Wolffenbuttel BH, Boomsma DI, Beckmann JS, Dedoussis GV, Deloukas P, Ferreira MA, Sanna S, Uda M, Hicks AA, Penninger JM, Gieger C, Kooner JS, Ouwehand WH, Soranzo N and Chambers JC.
Journal Nature 492 (7429), 369-375 (2012)
Title Slow, reversible, coupled folding and binding of the spectrin tetramerization domain .
Author Shammas SL, Rogers JM, Hill SA and Clarke J.
Journal Biophys. J. 103 (10), 2203-2214 (2012)
Title [Spectrin--variety of functions hidden in the structure] .
Author Wolny M, Wroblewska AM, Machnicka B and Sikorski AF.
Journal Postepy Biochem. 58 (3), 245-254 (2012)
Title A deletional frameshift mutation of the beta-spectrin gene associated with elliptocytosis in spectrin Tokyo (beta 220/216) .
Author Kanzaki A, Rabodonirina M, Yawata Y, Wilmotte R, Wada H, Ata K, Yamada O, Akatsuka J, Iyori H and Horiguchi M.
Journal Blood 80 (8), 2115-2121 (1992)
Title Properties of human red cell spectrin heterodimer (side-to-side) assembly and identification of an essential nucleation site .
Author Speicher DW, Weglarz L and DeSilva TM.
Journal J. Biol. Chem. 267 (21), 14775-14782 (1992)
Title Dinucleotide repeat polymorphism at the human erythroid alpha spectrin (SPTA1) locus .
Author Hentati A, Hu P, Asgharzadeh S and Siddique T.
Journal Hum. Mol. Genet. 1 (3), 218 (1992)
Title A common type of the spectrin alpha I 46-50a-kD peptide abnormality in hereditary elliptocytosis and pyropoikilocytosis is associated with a mutation distant from the proteolytic cleavage site. Evidence for the functional importance of the triple helical model of spectrin .
Author Gallagher PG, Tse WT, Coetzer T, Lecomte MC, Garbarz M, Zarkowsky HS, Baruchel A, Ballas SK, Dhermy D and Palek J.
Journal J. Clin. Invest. 89 (3), 892-898 (1992)
Title The membrane attachment protein for spectrin is associated with band 3 in human erythrocyte membranes .
Author Bennett,V. and Stenbuck,P.J.
Journal Nature 280 (5722), 468-473 (1979)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.