• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens sex determining region Y (SRY), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu28314 Homo sapiens sex determining region Y (SRY), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu28314C Homo sapiens sex determining region Y (SRY), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_003140.2, 519666780
Length 615 bp
Structure linear
Update Date 20-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens sex determining region Y (SRY), mRNA.
Product sex-determining region Y protein
Comment

Summary: This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome. [provided by RefSeq, Jul 2008].

RefSeq NP_003131.1
CDS 139..753
Misc Feature(1)1
Misc Feature(2)1
Misc Feature(3)79..81
Misc Feature(4)313..546
Misc Feature(5)313..546
Misc Feature(6)313..528
Misc Feature(7)319..369
Misc Feature(8)order(322..324,328..333,337..342,349..354,361..363,
Misc Feature(9)457..555
Misc Feature(10)526..546
Misc Feature(11)544..546
Misc Feature(12)550..603
Misc Feature(13)730..750
Exon (1)1..887
Gene:SRY
Gene Synonym:SRXX1; SRXY1; TDF; TDY
Translation MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRV KRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMH REKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQL GHLPPINAASSPQQRDRYSHWTKL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
142+c, tdbSNP:104894977
150+a, tdbSNP:104894975
191+a, gdbSNP:104894971
316+c, gdbSNP:104894957
330+a, gdbSNP:104894969
341+c, tdbSNP:104894968
347+a, gdbSNP:104894965
408+c, gdbSNP:104894959
412+a, tdbSNP:104894970
415+c, tdbSNP:104894958
421+c, gdbSNP:104894974
422+a, gdbSNP:104894972
455+a, tdbSNP:104894964
458+a, gdbSNP:104894967
464+c, tdbSNP:104894956
475+a, gdbSNP:104894966
518+a, tdbSNP:104894973
complement(521)-t, cdbSNP:375342012
535+c, tdbSNP:104894976
603+c, tdbSNP:11575897
complement(603)-g, adbSNP:386520035
Gene SymbolSRY
Gene SynonymSRXX1; SRXY1; TDF; TDY
ChromosomeY
Locus MapYp11.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003140 Homo sapiens sex determining region Y (SRY), mRNA. In-stock $99.00 5-7
Title MAS promoter regulation: a role for Sry and tyrosine nitration of the KRAB domain of ZNF274 as a feedback mechanism .
Author Prokop JW, Rauscher FJ 3rd, Peng H, Liu Y, Araujo FC, Watanabe I, Reis FM and Milsted A.
Journal Clin. Sci. 126 (10), 727-738 (2014)
Title Upstream open reading frames cause widespread reduction of protein expression and are polymorphic among humans .
Author Calvo SE, Pagliarini DJ and Mootha VK.
Journal Proc. Natl. Acad. Sci. U.S.A. 106 (18), 7507-7512 (2009)
Title Sex determination and SRY: down to a wink and a nudge? .
Author Sekido R and Lovell-Badge R.
Journal Trends Genet. 25 (1), 19-29 (2009)
Title The human SRY transcript .
Author Clepet C, Schafer AJ, Sinclair AH, Palmer MS, Lovell-Badge R and Goodfellow PN.
Journal Hum. Mol. Genet. 2 (12), 2007-2012 (1993)
Title Evidence that the SRY protein is encoded by a single exon on the human Y chromosome .
Author Behlke MA, Bogan JS, Beer-Romero P and Page DC.
Journal Genomics 17 (3), 736-739 (1993)
Title Identification of the transcriptional unit, structural organization, and promoter sequence of the human sex-determining region Y (SRY) gene, using a reverse genetic approach .
Author Su H and Lau YF.
Journal Am. J. Hum. Genet. 52 (1), 24-38 (1993)
Title 46,XY Disorder of Sex Development and 46,XY Complete Gonadal Dysgenesis .
Author Ostrer,H.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title 46,XX Testicular Disorder of Sex Development .
Author Vilain,E.J.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Mutational analysis of SRY: nonsense and missense mutations in XY sex reversal .
Author Hawkins JR, Taylor A, Berta P, Levilliers J, Van der Auwera B and Goodfellow PN.
Journal Hum. Genet. 88 (4), 471-474 (1992)
Title A gene from the human sex-determining region encodes a protein with homology to a conserved DNA-binding motif .
Author Sinclair AH, Berta P, Palmer MS, Hawkins JR, Griffiths BL, Smith MJ, Foster JW, Frischauf AM, Lovell-Badge R and Goodfellow PN.
Journal Nature 346 (6281), 240-244 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.