• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens signal transducer and activator of transcription 4 (STAT4), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18290 Homo sapiens signal transducer and activator of transcription 4 (STAT4), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu18290C Homo sapiens signal transducer and activator of transcription 4 (STAT4), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_003151.3, 345110658
Length 2247 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens signal transducer and activator of transcription 4 (STAT4), transcript variant 1, mRNA.
Product signal transducer and activator of transcription 4
Comment

Summary: The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is essential for mediating responses to IL12 in lymphocytes, and regulating the differentiation of T helper cells. Mutations in this gene may be associated with systemic lupus erythematosus and rheumatoid arthritis. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2011].


Transcript Variant: This variant (1) represents the longer transcript. Both variants 1 and 2 encode the same protein.

RefSeq NP_003142.1
CDS 316..2562
Misc Feature(1)301..303
Misc Feature(2)319..678
Misc Feature(3)319..678
Misc Feature(4)724..1257
Misc Feature(5)1261..2004
Misc Feature(6)1972..2415
Misc Feature(7)order(2053..2055,2107..2109,2185..2187,2191..2193)
Misc Feature(8)order(2188..2190,2236..2238)
Misc Feature(9)order(2218..2223,2407..2409)
Misc Feature(10)2392..2394
Misc Feature(11)2476..2478
Misc Feature(12)2476..2478
Exon (1)1..314
Gene:STAT4
Gene Synonym:SLEB11
Exon (2)315..443
Gene:STAT4
Gene Synonym:SLEB11
Exon (3)444..588
Gene:STAT4
Gene Synonym:SLEB11
Exon (4)589..687
Gene:STAT4
Gene Synonym:SLEB11
Exon (5)688..780
Gene:STAT4
Gene Synonym:SLEB11
Exon (6)781..859
Gene:STAT4
Gene Synonym:SLEB11
Exon (7)860..945
Gene:STAT4
Gene Synonym:SLEB11
Exon (8)946..1097
Gene:STAT4
Gene Synonym:SLEB11
Exon (9)1098..1256
Gene:STAT4
Gene Synonym:SLEB11
Exon (10)1257..1349
Gene:STAT4
Gene Synonym:SLEB11
Exon (11)1350..1409
Gene:STAT4
Gene Synonym:SLEB11
Exon (12)1410..1427
Gene:STAT4
Gene Synonym:SLEB11
Exon (13)1428..1521
Gene:STAT4
Gene Synonym:SLEB11
Exon (14)1522..1566
Gene:STAT4
Gene Synonym:SLEB11
Exon (15)1567..1650
Gene:STAT4
Gene Synonym:SLEB11
Exon (16)1651..1749
Gene:STAT4
Gene Synonym:SLEB11
Exon (17)1750..1885
Gene:STAT4
Gene Synonym:SLEB11
Exon (18)1886..1935
Gene:STAT4
Gene Synonym:SLEB11
Exon (19)1936..2030
Gene:STAT4
Gene Synonym:SLEB11
Exon (20)2031..2167
Gene:STAT4
Gene Synonym:SLEB11
Exon (21)2168..2359
Gene:STAT4
Gene Synonym:SLEB11
Exon (22)2360..2426
Gene:STAT4
Gene Synonym:SLEB11
Exon (23)2427..2535
Gene:STAT4
Gene Synonym:SLEB11
Exon (24)2536..2826
Gene:STAT4
Gene Synonym:SLEB11
Translation MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNL LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT MDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDLLMNTMLIEELQDWKR RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRTHM LERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKLPELNYQVKVK ASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCH MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL VFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCK EHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFS ESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPM SPSVYAVLRENLSPTTIETAMKSPYSAE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
59+dbSNP:
59+a, gdbSNP:2278940
complement(294)-t, gdbSNP:114318317
429+c, tdbSNP:35500382
complement(522)-dbSNP:
complement(522)-t, adbSNP:369256225
complement(530)-g, adbSNP:267599129
complement(575)-t, cdbSNP:202184860
complement(633)-dbSNP:
complement(633)-g, adbSNP:3024838
complement(658)-g, adbSNP:3024839
complement(667)-t, cdbSNP:372012413
complement(698)-dbSNP:
complement(698)-t, adbSNP:140675301
complement(705)-g, adbSNP:145071895
complement(742)-t, cdbSNP:370819441
complement(782)-dbSNP:
complement(782)-g, adbSNP:376677137
complement(784)-t, cdbSNP:372399682
819+a, gdbSNP:35918099
complement(822)-g, adbSNP:199940585
921+dbSNP:
921+a, tdbSNP:74378111
complement(927)-t, gdbSNP:144713478
complement(945)-t, cdbSNP:367890072
complement(955)-dbSNP:
complement(955)-t, cdbSNP:145218540
complement(969)-t, cdbSNP:139598810
complement(1011)-t, cdbSNP:371181176
complement(1034)-t, cdbSNP:61756200
complement(1048)-t, cdbSNP:201972198
complement(1056)-g, adbSNP:189939340
complement(1080)-g, adbSNP:138111228
complement(1093)-t, cdbSNP:113436186
complement(1120)-dbSNP:
complement(1120)-c, adbSNP:35279173
complement(1131)-t, cdbSNP:140221173
complement(1153)-t, cdbSNP:142125913
complement(1179)-g, adbSNP:138535661
complement(1191)-g, adbSNP:374707313
complement(1208)-g, adbSNP:200982266
complement(1245)-g, adbSNP:140970138
complement(1274)-dbSNP:
complement(1274)-t, cdbSNP:143642103
complement(1368)-dbSNP:
complement(1368)-t, gdbSNP:181250926
complement(1470)-dbSNP:
complement(1470)-t, cdbSNP:376043190
complement(1474)-t, cdbSNP:368876096
complement(1493)-g, cdbSNP:199633613
complement(1526)-dbSNP:
complement(1526)-g, adbSNP:200636478
complement(1599)-dbSNP:
complement(1599)-g, adbSNP:201192423
complement(1605)-t, cdbSNP:145312304
complement(1652)-dbSNP:
complement(1652)-g, adbSNP:141331848
complement(1653)-t, gdbSNP:144421302
complement(1713)-g, adbSNP:200929981
complement(1728)-g, adbSNP:142491497
complement(1739)-t, cdbSNP:146386562
complement(1752)-dbSNP:
complement(1752)-g, adbSNP:138956189
complement(1773)-g, adbSNP:79347691
complement(1776)-t, gdbSNP:77509921
complement(1786)-g, adbSNP:373669618
complement(1788)-c, adbSNP:149621054
complement(1791)-g, adbSNP:138191914
complement(1827)-t, cdbSNP:201470036
complement(1830)-g, adbSNP:139085875
complement(1838)-t, cdbSNP:376947712
complement(1853)-t, adbSNP:147007636
complement(1911)-dbSNP:
complement(1911)-g, adbSNP:147850919
complement(1955)-dbSNP:
complement(1955)-g, adbSNP:144091208
complement(1963)-g, adbSNP:373191999
2065+dbSNP:
2065+c, tdbSNP:3024933
complement(2065)-g, adbSNP:386578714
complement(2071)-t, gdbSNP:199609035
complement(2121)-g, cdbSNP:201150110
complement(2210)-t, cdbSNP:149089413
complement(2211)-c, adbSNP:112819248
complement(2229)-t, gdbSNP:369720896
complement(2287)-g, adbSNP:202018151
complement(2328)-g, adbSNP:368134591
complement(2355)-g, adbSNP:368928990
complement(2378)-dbSNP:
complement(2378)-t, cdbSNP:371989874
complement(2429)-dbSNP:
complement(2429)-t, cdbSNP:370218298
complement(2435)-t, cdbSNP:111535990
complement(2493)-t, cdbSNP:139030621
complement(2570)-c, adbSNP:3024906
complement(2575)-g, adbSNP:373725872
complement(2578)-g, adbSNP:199549890
complement(2579)-t, cdbSNP:376543078
complement(2582)-g, adbSNP:373617359
complement(2601)-t, cdbSNP:370883796
complement(2651)-t, cdbSNP:191594904
complement(2686)-t, cdbSNP:386578708
complement(2686)-g, adbSNP:3024907
complement(2723)-t, cdbSNP:148090220
complement(2724)-g, adbSNP:113109887
complement(2770)-t, adbSNP:2280236
Gene SymbolSTAT4
Gene SynonymSLEB11
Chromosome2
Locus Map2q32.2-q32.3
Title [Relationship of reduced lung function with Th1/Th2 polarization, STAT4/6 expression in rats of chronic obstructive pulmonary disease] .
Author Wang C and Li Z.
Journal Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi 29 (12), 1233-1236 (2013)
Title A genome-wide association study in Han Chinese identifies a susceptibility locus for primary Sjogren's syndrome at 7q11.23 .
Author Li Y, Zhang K, Chen H, Sun F, Xu J, Wu Z, Li P, Zhang L, Du Y, Luan H, Li X, Wu L, Li H, Wu H, Li X, Li X, Zhang X, Gong L, Dai L, Sun L, Zuo X, Xu J, Gong H, Li Z, Tong S, Wu M, Li X, Xiao W, Wang G, Zhu P, Shen M, Liu S, Zhao D, Liu W, Wang Y, Huang C, Jiang Q, Liu G, Liu B, Hu S, Zhang W, Zhang Z, You X, Li M, Hao W, Zhao C, Leng X, Bi L, Wang Y, Zhang F, Shi Q, Qi W, Zhang X, Jia Y, Su J, Li Q, Hou Y, Wu Q, Xu D, Zheng W, Zhang M, Wang Q, Fei Y, Zhang X, Li J, Jiang Y, Tian X, Zhao L, Wang L, Zhou B, Li Y, Zhao Y, Zeng X, Ott J, Wang J and Zhang F.
Journal Nat. Genet. 45 (11), 1361-1365 (2013)
Title Association of STAT4 polymorphisms with susceptibility to type-1 autoimmune hepatitis in the Japanese population .
Author Migita K, Nakamura M, Abiru S, Jiuchi Y, Nagaoka S, Komori A, Hashimoto S, Bekki S, Yamasaki K, Komatsu T, Shimada M, Kouno H, Hijioka T, Kohjima M, Nakamuta M, Kato M, Yoshizawa K, Ohta H, Nakamura Y, Takezaki E, Nishimura H, Sato T, Ario K, Hirashima N, Oohara Y, Naganuma A, Muro T, Sakai H, Mita E, Sugi K, Yamashita H, Makita F, Yatsuhashi H, Ishibashi H and Yasunami M.
Journal PLoS ONE 8 (8), E71382 (2013)
Title Association of STAT4 gene polymorphism with increased susceptibility of rheumatoid arthritis in a northern Chinese Han subpopulation .
Author Zhao Y, Liu X, Liu X, Su Y, Li Y, Zhang X, Zhu L, Wang S, Wang T, Jiang Q, Liu X, Li X, Huang C, Jia R, Lu X, Guo J and Li Z.
Journal Int J Rheum Dis 16 (2), 178-184 (2013)
Title Direct interaction of STAT4 with the IL-12 receptor .
Author Yao BB, Niu P, Surowy CS and Faltynek CR.
Journal Arch. Biochem. Biophys. 368 (1), 147-155 (1999)
Title Identification of a STAT4 binding site in the interleukin-12 receptor required for signaling .
Author Naeger LK, McKinney J, Salvekar A and Hoey T.
Journal J. Biol. Chem. 274 (4), 1875-1878 (1999)
Title cDNA cloning, expression and chromosome mapping of the human STAT4 gene: both STAT4 and STAT1 genes are mapped to 2q32.2-->q32.3 .
Author Yamamoto K, Kobayashi H, Arai A, Miura O, Hirosawa S and Miyasaka N.
Journal Cytogenet. Cell Genet. 77 (3-4), 207-210 (1997)
Title Requirement for Stat4 in interleukin-12-mediated responses of natural killer and T cells .
Author Thierfelder WE, van Deursen JM, Yamamoto K, Tripp RA, Sarawar SR, Carson RT, Sangster MY, Vignali DA, Doherty PC, Grosveld GC and Ihle JN.
Journal Nature 382 (6587), 171-174 (1996)
Title Interleukin 12 induces tyrosine phosphorylation and activation of STAT4 in human lymphocytes .
Author Bacon CM, Petricoin EF 3rd, Ortaldo JR, Rees RC, Larner AC, Johnston JA and O'Shea JJ.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (16), 7307-7311 (1995)
Title Stat4, a novel gamma interferon activation site-binding protein expressed in early myeloid differentiation .
Author Yamamoto K, Quelle FW, Thierfelder WE, Kreider BL, Gilbert DJ, Jenkins NA, Copeland NG, Silvennoinen O and Ihle JN.
Journal Mol. Cell. Biol. 14 (7), 4342-4349 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.