• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens signal transducer and activator of transcription 4 (STAT4), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003151 Homo sapiens signal transducer and activator of transcription 4 (STAT4), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $639.00 $590.00 15

*Business Day

Related Services

RefSeq Version NM_003151.3, 345110658
Length 2840 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens signal transducer and activator of transcription 4 (STAT4), transcript variant 1, mRNA.
Product signal transducer and activator of transcription 4
Comment

Summary: The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is essential for mediating responses to IL12 in lymphocytes, and regulating the differentiation of T helper cells. Mutations in this gene may be associated with systemic lupus erythematosus and rheumatoid arthritis. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2011].


Transcript Variant: This variant (1) represents the longer transcript. Both variants 1 and 2 encode the same protein.

RefSeq NP_003142.1
CDS 316..2562
Misc Feature(1)301..303
Misc Feature(2)319..678
Misc Feature(3)319..678
Misc Feature(4)724..1257
Misc Feature(5)1261..2004
Misc Feature(6)1972..2415
Misc Feature(7)order(2053..2055,2107..2109,2185..2187,2191..2193)
Misc Feature(8)order(2188..2190,2236..2238)
Misc Feature(9)order(2218..2223,2407..2409)
Misc Feature(10)2392..2394
Misc Feature(11)2476..2478
Misc Feature(12)2476..2478
Exon (1)1..314
Gene:STAT4
Gene Synonym:SLEB11
Exon (2)315..443
Gene:STAT4
Gene Synonym:SLEB11
Exon (3)444..588
Gene:STAT4
Gene Synonym:SLEB11
Exon (4)589..687
Gene:STAT4
Gene Synonym:SLEB11
Exon (5)688..780
Gene:STAT4
Gene Synonym:SLEB11
Exon (6)781..859
Gene:STAT4
Gene Synonym:SLEB11
Exon (7)860..945
Gene:STAT4
Gene Synonym:SLEB11
Exon (8)946..1097
Gene:STAT4
Gene Synonym:SLEB11
Exon (9)1098..1256
Gene:STAT4
Gene Synonym:SLEB11
Exon (10)1257..1349
Gene:STAT4
Gene Synonym:SLEB11
Exon (11)1350..1409
Gene:STAT4
Gene Synonym:SLEB11
Exon (12)1410..1427
Gene:STAT4
Gene Synonym:SLEB11
Exon (13)1428..1521
Gene:STAT4
Gene Synonym:SLEB11
Exon (14)1522..1566
Gene:STAT4
Gene Synonym:SLEB11
Exon (15)1567..1650
Gene:STAT4
Gene Synonym:SLEB11
Exon (16)1651..1749
Gene:STAT4
Gene Synonym:SLEB11
Exon (17)1750..1885
Gene:STAT4
Gene Synonym:SLEB11
Exon (18)1886..1935
Gene:STAT4
Gene Synonym:SLEB11
Exon (19)1936..2030
Gene:STAT4
Gene Synonym:SLEB11
Exon (20)2031..2167
Gene:STAT4
Gene Synonym:SLEB11
Exon (21)2168..2359
Gene:STAT4
Gene Synonym:SLEB11
Exon (22)2360..2426
Gene:STAT4
Gene Synonym:SLEB11
Exon (23)2427..2535
Gene:STAT4
Gene Synonym:SLEB11
Exon (24)2536..2826
Gene:STAT4
Gene Synonym:SLEB11
Translation MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNL LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT MDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDLLMNTMLIEELQDWKR RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRTHM LERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKLPELNYQVKVK ASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCH MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL VFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCK EHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFS ESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPM SPSVYAVLRENLSPTTIETAMKSPYSAE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(59)-dbSNP:
complement(59)-g, adbSNP:2278940
complement(294)-t, gdbSNP:114318317
complement(429)-t, cdbSNP:35500382
complement(575)-dbSNP:
complement(575)-t, cdbSNP:202184860
complement(633)-dbSNP:
complement(633)-g, adbSNP:3024838
complement(658)-g, adbSNP:3024839
complement(698)-dbSNP:
complement(698)-t, adbSNP:140675301
complement(705)-g, adbSNP:145071895
complement(819)-dbSNP:
complement(819)-g, adbSNP:35918099
complement(822)-g, adbSNP:199940585
complement(921)-dbSNP:
complement(921)-t, adbSNP:74378111
complement(927)-t, gdbSNP:144713478
complement(955)-dbSNP:
complement(955)-t, cdbSNP:145218540
complement(969)-t, cdbSNP:139598810
complement(975)-g, adbSNP:145200528
complement(1034)-t, cdbSNP:61756200
complement(1048)-t, cdbSNP:201972198
complement(1056)-g, adbSNP:189939340
complement(1080)-g, adbSNP:138111228
complement(1093)-t, cdbSNP:113436186
complement(1120)-dbSNP:
complement(1120)-c, adbSNP:35279173
complement(1131)-t, cdbSNP:140221173
complement(1153)-t, cdbSNP:142125913
complement(1179)-g, adbSNP:138535661
complement(1208)-g, adbSNP:200982266
complement(1245)-g, adbSNP:140970138
complement(1274)-dbSNP:
complement(1274)-t, cdbSNP:143642103
complement(1368)-dbSNP:
complement(1368)-t, gdbSNP:181250926
complement(1493)-dbSNP:
complement(1493)-g, cdbSNP:199633613
complement(1526)-dbSNP:
complement(1526)-g, adbSNP:200636478
complement(1599)-dbSNP:
complement(1599)-g, adbSNP:201192423
complement(1605)-t, cdbSNP:145312304
complement(1646)-, adbSNP:66818798
complement(1652)-dbSNP:
complement(1652)-g, adbSNP:141331848
complement(1653)-t, gdbSNP:144421302
complement(1713)-g, adbSNP:200929981
complement(1728)-g, adbSNP:142491497
complement(1739)-t, cdbSNP:146386562
complement(1752)-dbSNP:
complement(1752)-g, adbSNP:138956189
complement(1773)-g, adbSNP:79347691
complement(1776)-t, gdbSNP:77509921
complement(1788)-c, adbSNP:149621054
complement(1791)-g, adbSNP:138191914
complement(1827)-t, cdbSNP:201470036
complement(1830)-g, adbSNP:139085875
complement(1853)-t, adbSNP:147007636
complement(1911)-dbSNP:
complement(1911)-g, adbSNP:147850919
complement(1955)-dbSNP:
complement(1955)-g, adbSNP:144091208
complement(2065)-dbSNP:
complement(2065)-t, cdbSNP:3024933
complement(2071)-t, gdbSNP:199609035
complement(2121)-g, cdbSNP:201150110
complement(2210)-t, cdbSNP:149089413
complement(2211)-c, adbSNP:112819248
complement(2287)-g, adbSNP:202018151
complement(2435)-dbSNP:
complement(2435)-t, cdbSNP:111535990
complement(2493)-t, cdbSNP:139030621
complement(2570)-c, adbSNP:3024906
complement(2578)-g, adbSNP:199549890
complement(2651)-t, cdbSNP:191594904
complement(2686)-g, adbSNP:3024907
complement(2723)-t, cdbSNP:148090220
complement(2724)-g, adbSNP:113109887
complement(2770)-t, adbSNP:2280236
Gene SymbolSTAT4
Gene SynonymSLEB11
Chromosome2
Locus Map2q32.2-q32.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001243835 Homo sapiens signal transducer and activator of transcription 4 (STAT4), transcript variant 2, mRNA. In-stock $639.00 $590.00 15
NM_003151 Homo sapiens signal transducer and activator of transcription 4 (STAT4), transcript variant 1, mRNA. In-stock $639.00 $590.00 15
Title Genetic variants of STAT-4 affect the development of graft fibrosis after liver transplantation for HCV-induced liver disease .
Author Eurich,D., Boas-Knoop,S., Struecker,B., Neuhaus,R., Neuhaus,P. and Bahra,M.
Journal Transplantation 95 (1), 203-208 (2013)
Title Genetic variants in STAT4 and HLA-DQ genes confer risk of hepatitis .
Author Jiang,D.K., Sun,J., Cao,G., Liu,Y., Lin,D., Gao,Y.Z., Ren,W.H., Long,X.D., Zhang,H., Ma,X.P., Wang,Z., Jiang,W., Chen,T.Y., Gao,Y., Sun,L.D., Long,J.R., Huang,H.X., Wang,D., Yu,H., Zhang,P., Tang,L.S., Peng,B., Cai,H., Liu,T.T., Zhou,P., Liu,F., Lin,X., Tao,S., Wan,B., Sai-Yin,H.X., Qin,L.X., Yin,J., Liu,L., Wu,C., Pei,Y., Zhou,Y.F., Zhai,Y., Lu,P.X., Tan,A., Zuo,X.B., Fan,J., Chang,J., Gu,X., Wang,N.J., Li,Y., Liu,Y.K., Zhai,K., Zhang,H., Hu,Z., Liu,J., Yi,Q., Xiang,Y., Shi,R., Ding,Q., Zheng,W., Shu,X.O., Mo,Z., Shugart,Y.Y., Zhang,X.J., Zhou,G., Shen,H., Zheng,S.L., Xu,J. and Yu,L.
Journal Nat. Genet. 45 (1), 72-75 (2013)
Title Identification of a susceptibility locus in STAT4 for Behcet's disease in Han Chinese in a genome-wide association study .
Author Hou,S., Yang,Z., Du,L., Jiang,Z., Shu,Q., Chen,Y., Li,F., Zhou,Q., Ohno,S., Chen,R., Kijlstra,A., Rosenbaum,J.T. and Yang,P.
Journal Arthritis Rheum. 64 (12), 4104-4113 (2012)
Title Increased IL-21 secretion by aged CD4+T cells is associated with prolonged STAT-4 activation and CMV seropositivity .
Author Agrawal,A., Su,H., Chen,J., Osann,K., Agrawal,S. and Gupta,S.
Journal Aging (Albany NY) 4 (9), 648-659 (2012)
Title Direct interaction of STAT4 with the IL-12 receptor .
Author Yao,B.B., Niu,P., Surowy,C.S. and Faltynek,C.R.
Journal Arch. Biochem. Biophys. 368 (1), 147-155 (1999)
Title Identification of a STAT4 binding site in the interleukin-12 receptor required for signaling .
Author Naeger,L.K., McKinney,J., Salvekar,A. and Hoey,T.
Journal J. Biol. Chem. 274 (4), 1875-1878 (1999)
Title cDNA cloning, expression and chromosome mapping of the human STAT4 gene: both STAT4 and STAT1 genes are mapped to 2q32.2-->q32.3 .
Author Yamamoto,K., Kobayashi,H., Arai,A., Miura,O., Hirosawa,S. and Miyasaka,N.
Journal Cytogenet. Cell Genet. 77 (3-4), 207-210 (1997)
Title Requirement for Stat4 in interleukin-12-mediated responses of natural killer and T cells .
Author Thierfelder,W.E., van Deursen,J.M., Yamamoto,K., Tripp,R.A., Sarawar,S.R., Carson,R.T., Sangster,M.Y., Vignali,D.A., Doherty,P.C., Grosveld,G.C. and Ihle,J.N.
Journal Nature 382 (6587), 171-174 (1996)
Title Interleukin 12 induces tyrosine phosphorylation and activation of STAT4 in human lymphocytes .
Author Bacon,C.M., Petricoin,E.F. III, Ortaldo,J.R., Rees,R.C., Larner,A.C., Johnston,J.A. and O'Shea,J.J.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (16), 7307-7311 (1995)
Title Stat4, a novel gamma interferon activation site-binding protein expressed in early myeloid differentiation .
Author Yamamoto,K., Quelle,F.W., Thierfelder,W.E., Kreider,B.L., Gilbert,D.J., Jenkins,N.A., Copeland,N.G., Silvennoinen,O. and Ihle,J.N.
Journal Mol. Cell. Biol. 14 (7), 4342-4349 (1994)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.