• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ADAM metallopeptidase domain 17 (ADAM17), mRNA.


RefSeq Accession Definition Services Price Order
NM_003183 Homo sapiens ADAM metallopeptidase domain 17 (ADAM17), mRNA. ORF Sequence $717.75
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_003183.4, 73747888
Length 3572 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ADAM metallopeptidase domain 17 (ADAM17), mRNA.
Product disintegrin and metalloproteinase domain-containing protein 17 preproprotein
Comment

Summary: This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene functions as a tumor necrosis factor-alpha converting enzyme; binds mitotic arrest deficient 2 protein; and also plays a prominent role in the activation of the Notch signaling pathway. [provided by RefSeq, Jul 2008].

RefSeq NP_003174.3
CDS 184..2658
Misc Feature(1)82..84
Misc Feature(2)340..684
Misc Feature(3)727..750
Misc Feature(4)850..1614
Misc Feature(5)1318..1320
Misc Feature(6)1327..1329
Misc Feature(7)order(1396..1401,1408..1410,1426..1428)
Misc Feature(8)1633..1863
Misc Feature(9)1894..1989
Misc Feature(10)1990..2196
Misc Feature(11)2197..2265
Misc Feature(12)2197..2259
Misc Feature(13)2266..2655
Misc Feature(14)2386..2388
Misc Feature(15)2554..2556
Misc Feature(16)2554..2556
Misc Feature(17)2554..2556
Misc Feature(18)2638..2640
Misc Feature(19)2638..2640
Exon (1)1..280
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (2)281..413
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (3)414..544
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (4)545..633
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (5)634..802
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (6)803..936
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (7)937..1026
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (8)1027..1140
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (9)1141..1285
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (10)1286..1374
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (11)1375..1527
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (12)1528..1727
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (13)1728..1831
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (14)1832..1966
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (15)1967..2097
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (16)2098..2176
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (17)2177..2265
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (18)2266..2316
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (19)2317..3572
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Translation MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDL QTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVV GEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQS PKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYRYMG RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNM AKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS HGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN SRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINA TCKGVSYCTGNSSECPPPGNAEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSC KVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHPSNVEMLSSMD SASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKD PFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(12)-dbSNP:
complement(12)-g, adbSNP:12692386
complement(30)-c, adbSNP:55790676
complement(41)-g, adbSNP:189110504
complement(146)-g, cdbSNP:200520450
complement(148)-c, adbSNP:139691809
complement(166)-g, cdbSNP:201127286
complement(193)-g, adbSNP:201578288
complement(236)-g, adbSNP:144458353
complement(247)-c, adbSNP:146033784
complement(264)-g, adbSNP:138046330
complement(269)-t, cdbSNP:182108217
complement(331)-dbSNP:
complement(331)-t, cdbSNP:61754178
complement(361)-t, gdbSNP:112594248
complement(390)-t, cdbSNP:141846970
complement(402)-t, gdbSNP:113429723
complement(415)-dbSNP:
complement(415)-g, cdbSNP:77759270
complement(477)-c, adbSNP:149899785
complement(580)-dbSNP:
complement(580)-t, cdbSNP:199524645
complement(618)-g, cdbSNP:143124556
complement(667)-dbSNP:
complement(667)-g, adbSNP:34431503
complement(680)-g, adbSNP:148451347
complement(719)-t, cdbSNP:139401611
complement(787)-t, g, adbSNP:2230818
complement(827)-dbSNP:
complement(827)-c, adbSNP:142946965
complement(845)-c, adbSNP:200778881
complement(960)-dbSNP:
complement(960)-g, adbSNP:146893995
complement(975)-g, adbSNP:199651827
complement(990)-g, adbSNP:200972600
complement(1111)-dbSNP:
complement(1111)-g, cdbSNP:200988113
complement(1122)-g, adbSNP:201786766
complement(1123)-t, cdbSNP:201123474
complement(1175)-dbSNP:
complement(1175)-t, gdbSNP:151089669
complement(1177)-t, cdbSNP:199788242
complement(1249)-g, adbSNP:148983888
complement(1264)-g, adbSNP:201481056
complement(1303)-dbSNP:
complement(1303)-t, cdbSNP:199755899
complement(1380)-dbSNP:
complement(1380)-g, adbSNP:201738148
complement(1433)-g, adbSNP:201789177
complement(1500)-g, adbSNP:200399376
complement(1555)-dbSNP:
complement(1555)-t, cdbSNP:143293318
complement(1559)-t, cdbSNP:201873770
complement(1574)-t, cdbSNP:146433601
complement(1626)-t, cdbSNP:144137945
complement(1654)-t, cdbSNP:55937573
complement(1693)-t, cdbSNP:201743292
complement(1694)-t, cdbSNP:200446953
complement(1804)-dbSNP:
complement(1804)-t, cdbSNP:144014465
complement(1824)-g, adbSNP:147475420
complement(1878)-dbSNP:
complement(1878)-g, adbSNP:56237316
complement(2007)-dbSNP:
complement(2007)-t, cdbSNP:1048610
complement(2012)-c, adbSNP:140536552
complement(2016)-g, adbSNP:200055210
complement(2133)-dbSNP:
complement(2133)-t, cdbSNP:112463036
complement(2153)-t, cdbSNP:144657795
complement(2168)-t, cdbSNP:140933944
complement(2200)-t, cdbSNP:61754177
complement(2256)-t, cdbSNP:34355677
complement(2337)-dbSNP:
complement(2337)-g, adbSNP:202041986
complement(2351)-g, cdbSNP:144721235
complement(2357)-t, cdbSNP:147275585
complement(2378)-g, adbSNP:181463078
complement(2382)-g, cdbSNP:148093044
complement(2406)-g, adbSNP:200268337
complement(2423)-t, cdbSNP:55796712
complement(2426)-g, adbSNP:79932015
complement(2522)-t, cdbSNP:150324089
complement(2529)-g, adbSNP:201360504
complement(2531)-t, gdbSNP:78855175
complement(2571)-t, cdbSNP:149361049
complement(2635)-g, cdbSNP:142315365
complement(2719)-, adbSNP:3833563
complement(2733)-t, cdbSNP:6705408
complement(2948)-g, adbSNP:1130094
complement(3019..3020)-, adbSNP:5829218
complement(3021..3022)-, adbSNP:111759422
complement(3038)-t, cdbSNP:73149881
complement(3083..3086)-, actadbSNP:77130641
complement(3090)-c, adbSNP:189060518
complement(3190)-t, cdbSNP:139684774
complement(3233)-g, adbSNP:10063
complement(3245)-t, cdbSNP:184660941
complement(3339)-t, adbSNP:192681806
complement(3416..3417)-, gtaadbSNP:71636812
complement(3418..3419)-, agtadbSNP:144681167
Gene SymbolADAM17
Gene SynonymADAM18; CD156B; CSVP; NISBD; TACE
Chromosome2
Locus Map2p25
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_003183 Homo sapiens ADAM metallopeptidase domain 17 (ADAM17), mRNA. Full Length $1250.20
ORF Sequence $717.75
Title Identification of novel interaction between ADAM17 (a disintegrin and metalloprotease 17) and thioredoxin-1 .
Author Aragao,A.Z., Nogueira,M.L., Granato,D.C., Simabuco,F.M., Honorato,R.V., Hoffman,Z., Yokoo,S., Laurindo,F.R., Squina,F.M., Zeri,A.C., Oliveira,P.S., Sherman,N.E. and Paes Leme,A.F.
Journal J. Biol. Chem. 287 (51), 43071-43082 (2012)
Title Formation of the collateral circulation is regulated by vascular endothelial growth factor-A and a disintegrin and metalloprotease family members 10 and 17 .
Author Lucitti,J.L., Mackey,J.K., Morrison,J.C., Haigh,J.J., Adams,R.H. and Faber,J.E.
Journal Circ. Res. 111 (12), 1539-1550 (2012)
Title Direct observation of proteolytic cleavage at the S2 site upon forced unfolding of the Notch negative regulatory region .
Author Stephenson,N.L. and Avis,J.M.
Journal Proc. Natl. Acad. Sci. U.S.A. 109 (41), E2757-E2765 (2012)
Title Thioredoxin-80 is a product of alpha-secretase cleavage that inhibits amyloid-beta aggregation and is decreased in Alzheimer's disease brain .
Author Gil-Bea,F., Akterin,S., Persson,T., Mateos,L., Sandebring,A., Avila-Carino,J., Gutierrez-Rodriguez,A., Sundstrom,E., Holmgren,A., Winblad,B. and Cedazo-Minguez,A.
Journal EMBO Mol Med 4 (10), 1097-1111 (2012)
Title [Inhibitory effect of siRNA targeting ADAM17 on the proliferation of prostate cancer PC-3 cells] .
Author Lin,F., Lin,P., Liu,X., Li,D., Liu,Z.J., Zou,H.F., Jiang,Y., Zhao,X.F., Feng,J.L. and Yu,X.G.
Journal Zhonghua Nan Ke Xue 18 (8), 687-691 (2012)
Title Notch-1 signalling requires ligand-induced proteolytic release of intracellular domain .
Author Schroeter,E.H., Kisslinger,J.A. and Kopan,R.
Journal Nature 393 (6683), 382-386 (1998)
Title TNF-alpha convertase enzyme from human arthritis-affected cartilage: isolation of cDNA by differential display, expression of the active enzyme, and regulation of TNF-alpha .
Author Patel,I.R., Attur,M.G., Patel,R.N., Stuchin,S.A., Abagyan,R.A., Abramson,S.B. and Amin,A.R.
Journal J. Immunol. 160 (9), 4570-4579 (1998)
Title Crystal structure of the catalytic domain of human tumor necrosis factor-alpha-converting enzyme .
Author Maskos,K., Fernandez-Catalan,C., Huber,R., Bourenkov,G.P., Bartunik,H., Ellestad,G.A., Reddy,P., Wolfson,M.F., Rauch,C.T., Castner,B.J., Davis,R., Clarke,H.R., Petersen,M., Fitzner,J.N., Cerretti,D.P., March,C.J., Paxton,R.J., Black,R.A. and Bode,W.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (7), 3408-3412 (1998)
Title Cloning of a disintegrin metalloproteinase that processes precursor tumour-necrosis factor-alpha .
Author Moss,M.L., Jin,S.L., Milla,M.E., Bickett,D.M., Burkhart,W., Carter,H.L., Chen,W.J., Clay,W.C., Didsbury,J.R., Hassler,D., Hoffman,C.R., Kost,T.A., Lambert,M.H., Leesnitzer,M.A., McCauley,P., McGeehan,G., Mitchell,J., Moyer,M., Pahel,G., Rocque,W., Overton,L.K., Schoenen,F., Seaton,T., Su,J.L., Becherer,J.D. et al.
Journal Nature 385 (6618), 733-736 (1997)
Title A metalloproteinase disintegrin that releases tumour-necrosis factor-alpha from cells .
Author Black,R.A., Rauch,C.T., Kozlosky,C.J., Peschon,J.J., Slack,J.L., Wolfson,M.F., Castner,B.J., Stocking,K.L., Reddy,P., Srinivasan,S., Nelson,N., Boiani,N., Schooley,K.A., Gerhart,M., Davis,R., Fitzner,J.N., Johnson,R.S., Paxton,R.J., March,C.J. and Cerretti,D.P.
Journal Nature 385 (6618), 729-733 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878