• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ADAM metallopeptidase domain 17 (ADAM17), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu21940 Homo sapiens ADAM metallopeptidase domain 17 (ADAM17), mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu21940C Homo sapiens ADAM metallopeptidase domain 17 (ADAM17), mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_003183.4, 73747888
Length 2475 bp
Structure linear
Update Date 06-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens ADAM metallopeptidase domain 17 (ADAM17), mRNA.
Product disintegrin and metalloproteinase domain-containing protein 17 preproprotein
Comment

Summary: This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene functions as a tumor necrosis factor-alpha converting enzyme; binds mitotic arrest deficient 2 protein; and also plays a prominent role in the activation of the Notch signaling pathway. [provided by RefSeq, Jul 2008].

RefSeq NP_003174.3
CDS 184..2658
Misc Feature(1)82..84
Misc Feature(2)307..684
Misc Feature(3)727..750
Misc Feature(4)850..1614
Misc Feature(5)1318..1320
Misc Feature(6)1327..1329
Misc Feature(7)order(1396..1401,1408..1410,1426..1428)
Misc Feature(8)1633..1863
Misc Feature(9)1894..1989
Misc Feature(10)1990..2196
Misc Feature(11)2197..2265
Misc Feature(12)2197..2259
Misc Feature(13)2266..2655
Misc Feature(14)2386..2388
Misc Feature(15)2554..2556
Misc Feature(16)2554..2556
Misc Feature(17)2554..2556
Misc Feature(18)2638..2640
Misc Feature(19)2638..2640
Exon (1)1..280
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (2)281..413
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (3)414..544
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (4)545..633
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (5)634..802
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (6)803..936
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (7)937..1026
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (8)1027..1140
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (9)1141..1285
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (10)1286..1374
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (11)1375..1527
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (12)1528..1727
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (13)1728..1831
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (14)1832..1966
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (15)1967..2097
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (16)2098..2176
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (17)2177..2265
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (18)2266..2316
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Exon (19)2317..3572
Gene:ADAM17
Gene Synonym:ADAM18; CD156B; CSVP; NISBD; TACE
Translation MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDL QTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVV GEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQS PKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYRYMG RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNM AKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS HGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN SRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINA TCKGVSYCTGNSSECPPPGNAEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSC KVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHPSNVEMLSSMD SASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKD PFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(12)-dbSNP:
complement(12)-g, adbSNP:12692386
30+a, cdbSNP:55790676
complement(41)-g, adbSNP:189110504
complement(146)-g, cdbSNP:200520450
complement(148)-c, adbSNP:139691809
complement(153)-t, cdbSNP:368396944
complement(166)-g, cdbSNP:201127286
complement(193)-g, adbSNP:201578288
complement(236)-g, adbSNP:144458353
complement(247)-c, adbSNP:146033784
complement(264)-g, adbSNP:138046330
complement(269)-t, cdbSNP:182108217
complement(331)-dbSNP:
complement(331)-t, cdbSNP:61754178
complement(361)-t, gdbSNP:112594248
complement(390)-t, cdbSNP:141846970
complement(402)-t, gdbSNP:113429723
complement(415)-dbSNP:
complement(415)-g, cdbSNP:77759270
complement(472)-c, adbSNP:377513734
complement(477)-c, adbSNP:149899785
complement(537)-g, adbSNP:373534760
complement(541)-c, adbSNP:370085865
complement(580)-dbSNP:
complement(580)-t, cdbSNP:199524645
complement(618)-g, cdbSNP:143124556
complement(667)-dbSNP:
complement(667)-g, adbSNP:34431503
complement(675)-t, cdbSNP:374243206
complement(719)-t, cdbSNP:139401611
786..789+, cagadbSNP:387906866
complement(787)-t, g, adbSNP:2230818
complement(787)-g, adbSNP:386541049
complement(827)-dbSNP:
complement(827)-c, adbSNP:142946965
complement(835)-t, gdbSNP:373192089
complement(845)-c, adbSNP:200778881
complement(928)-t, cdbSNP:369378891
complement(960)-dbSNP:
complement(960)-g, adbSNP:146893995
complement(975)-g, adbSNP:199651827
complement(990)-g, adbSNP:200972600
complement(1031)-dbSNP:
complement(1031)-t, cdbSNP:375162225
complement(1086)-t, cdbSNP:371791651
complement(1111)-g, cdbSNP:200988113
complement(1122)-g, adbSNP:201786766
complement(1123)-t, cdbSNP:201123474
complement(1131)-t, cdbSNP:367951580
complement(1175)-dbSNP:
complement(1175)-t, gdbSNP:151089669
complement(1177)-t, cdbSNP:199788242
complement(1249)-g, adbSNP:148983888
complement(1264)-g, adbSNP:201481056
complement(1303)-dbSNP:
complement(1303)-t, cdbSNP:199755899
complement(1380)-dbSNP:
complement(1380)-g, adbSNP:201738148
complement(1421)-g, adbSNP:374447820
complement(1433)-g, adbSNP:201789177
complement(1500)-g, adbSNP:200399376
complement(1555)-dbSNP:
complement(1555)-t, cdbSNP:143293318
complement(1559)-t, cdbSNP:201873770
complement(1574)-t, cdbSNP:146433601
complement(1601)-t, cdbSNP:368697823
complement(1616)-c, adbSNP:376540653
complement(1626)-t, cdbSNP:144137945
1654+c, tdbSNP:55937573
complement(1693)-t, cdbSNP:201743292
complement(1694)-t, cdbSNP:200446953
complement(1696)-t, cdbSNP:372967979
complement(1769)-dbSNP:
complement(1769)-g, cdbSNP:372323794
complement(1794)-t, cdbSNP:368127694
complement(1804)-t, cdbSNP:144014465
complement(1814)-g, cdbSNP:375981644
complement(1824)-g, adbSNP:147475420
complement(1878)-dbSNP:
complement(1878)-g, adbSNP:56237316
2007+dbSNP:
2007+c, tdbSNP:1048610
complement(2012)-c, adbSNP:140536552
complement(2016)-g, adbSNP:200055210
complement(2077)-t, cdbSNP:371598292
complement(2133)-dbSNP:
complement(2133)-t, cdbSNP:112463036
complement(2153)-t, cdbSNP:144657795
complement(2168)-t, cdbSNP:140933944
complement(2178)-dbSNP:
complement(2178)-t, cdbSNP:369229801
complement(2200)-t, cdbSNP:61754177
complement(2256)-t, cdbSNP:34355677
complement(2261)-t, cdbSNP:375942302
complement(2301)-dbSNP:
complement(2301)-g, adbSNP:370157347
complement(2323)-dbSNP:
complement(2323)-t, cdbSNP:369159078
complement(2337)-g, adbSNP:202041986
complement(2351)-g, cdbSNP:144721235
complement(2357)-t, cdbSNP:147275585
complement(2371)-g, adbSNP:372189309
complement(2378)-g, adbSNP:181463078
complement(2382)-g, cdbSNP:148093044
complement(2388)-c, adbSNP:374390369
complement(2395)-g, adbSNP:370064783
complement(2406)-g, adbSNP:200268337
complement(2423)-t, cdbSNP:55796712
complement(2424)-t, cdbSNP:376456430
complement(2426)-g, adbSNP:79932015
complement(2431)-t, cdbSNP:374624230
complement(2445)-g, cdbSNP:370037406
complement(2463)-g, adbSNP:371018540
complement(2502)-g, adbSNP:376241260
complement(2529)-g, adbSNP:201360504
complement(2531)-t, gdbSNP:78855175
complement(2571)-t, cdbSNP:149361049
complement(2635)-g, cdbSNP:142315365
complement(2689)-g, cdbSNP:371014633
complement(2717)-, tdbSNP:397871862
complement(2719..2723)-, ttgatdbSNP:374487688
2719+, adbSNP:3833563
complement(2733)-t, cdbSNP:6705408
complement(2854)-t, cdbSNP:377317204
2948+a, gdbSNP:1130094
complement(3011..3012)-, adbSNP:5829218
complement(3020..3021)-, adbSNP:111759422
complement(3038)-t, cdbSNP:73149881
complement(3083..3086)-, actadbSNP:77130641
complement(3090)-c, adbSNP:189060518
complement(3190)-t, cdbSNP:139684774
3233+a, gdbSNP:10063
complement(3245)-t, cdbSNP:184660941
complement(3339)-t, adbSNP:192681806
complement(3417..3418)-, agta, gtaadbSNP:369296635
complement(3418..3419)-, agtadbSNP:144681167
complement(3517)-t, gdbSNP:371153381
complement(3552..3553)-, ttdbSNP:34525911
Gene SymbolADAM17
Gene SynonymADAM18; CD156B; CSVP; NISBD; TACE
Chromosome2
Locus Map2p25
Title A disintegrin and metalloproteinase 17 (ADAM17) mediates epidermal growth factor receptor transactivation by angiotensin II on hepatic stellate cells .
Author Oikawa H, Maesawa C, Tatemichi Y, Nishinari Y, Nishiya M, Mizugai H, Ikeda A, Oikawa K, Takikawa Y and Masuda T.
Journal Life Sci. 97 (2), 137-144 (2014)
Title Soluble T cell immunoglobulin and mucin domain (TIM)-1 and -4 generated by A Disintegrin And Metalloprotease (ADAM)-10 and -17 bind to phosphatidylserine .
Author Schweigert O, Dewitz C, Moller-Hackbarth K, Trad A, Garbers C, Rose-John S and Scheller J.
Journal Biochim. Biophys. Acta 1843 (2), 275-287 (2014)
Title Polo-like kinase 2, a novel ADAM17 signaling component, regulates tumor necrosis factor alpha ectodomain shedding .
Author Schwarz J, Schmidt S, Will O, Koudelka T, Kohler K, Boss M, Rabe B, Tholey A, Scheller J, Schmidt-Arras D, Schwake M, Rose-John S and Chalaris A.
Journal J. Biol. Chem. 289 (5), 3080-3093 (2014)
Title ADAM17-mediated shedding of FcgammaRIIIA on human NK cells: identification of the cleavage site and relationship with activation .
Author Lajoie L, Congy-Jolivet N, Bolzec A, Gouilleux-Gruart V, Sicard E, Sung HC, Peiretti F, Moreau T, Vie H, Clemenceau B and Thibault G.
Journal J. Immunol. 192 (2), 741-751 (2014)
Title A new paradigm for enzymatic control of alpha-cleavage and beta-cleavage of the prion protein .
Author McDonald AJ, Dibble JP, Evans EG and Millhauser GL.
Journal J. Biol. Chem. 289 (2), 803-813 (2014)
Title Notch-1 signalling requires ligand-induced proteolytic release of intracellular domain .
Author Schroeter EH, Kisslinger JA and Kopan R.
Journal Nature 393 (6683), 382-386 (1998)
Title TNF-alpha convertase enzyme from human arthritis-affected cartilage: isolation of cDNA by differential display, expression of the active enzyme, and regulation of TNF-alpha .
Author Patel IR, Attur MG, Patel RN, Stuchin SA, Abagyan RA, Abramson SB and Amin AR.
Journal J. Immunol. 160 (9), 4570-4579 (1998)
Title Crystal structure of the catalytic domain of human tumor necrosis factor-alpha-converting enzyme .
Author Maskos K, Fernandez-Catalan C, Huber R, Bourenkov GP, Bartunik H, Ellestad GA, Reddy P, Wolfson MF, Rauch CT, Castner BJ, Davis R, Clarke HR, Petersen M, Fitzner JN, Cerretti DP, March CJ, Paxton RJ, Black RA and Bode W.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (7), 3408-3412 (1998)
Title Cloning of a disintegrin metalloproteinase that processes precursor tumour-necrosis factor-alpha .
Author Moss ML, Jin SL, Milla ME, Bickett DM, Burkhart W, Carter HL, Chen WJ, Clay WC, Didsbury JR, Hassler D, Hoffman CR, Kost TA, Lambert MH, Leesnitzer MA, McCauley P, McGeehan G, Mitchell J, Moyer M, Pahel G, Rocque W, Overton LK, Schoenen F, Seaton T, Su JL and Becherer JD.
Journal Nature 385 (6618), 733-736 (1997)
Title A metalloproteinase disintegrin that releases tumour-necrosis factor-alpha from cells .
Author Black RA, Rauch CT, Kozlosky CJ, Peschon JJ, Slack JL, Wolfson MF, Castner BJ, Stocking KL, Reddy P, Srinivasan S, Nelson N, Boiani N, Schooley KA, Gerhart M, Davis R, Fitzner JN, Johnson RS, Paxton RJ, March CJ and Cerretti DP.
Journal Nature 385 (6618), 729-733 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.