• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu40448 Homo sapiens transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu40448C Homo sapiens transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant 1, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_003220.2, 109389359
Length 1314 bp
Structure linear
Update Date 19-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant 1, mRNA.
Product transcription factor AP-2-alpha isoform a
Comment

Summary: The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Dec 2009].


Transcript Variant: This variant (1) encodes the longest isoform (a).


CCDS Note: A downstream start codon is used for this CCDS representation based on sequencing of the purified protein in PMID:3063603, which shows that the second in-frame start codon is used. An upstream start codon exists and would result in a protein that is 2 aa longer at the N-terminus, but there is currently no evidence for this longer protein.

RefSeq NP_003211.1
CDS 253..1566
Misc Feature(1)307..309
Misc Feature(2)307..309
Misc Feature(3)307..309
Misc Feature(4)307..309
Misc Feature(5)421..438
Misc Feature(6)877..1494
Misc Feature(7)967..969
Misc Feature(8)1090..1482
Exon (1)1..297
Gene:TFAP2A
Gene Synonym:AP-2; AP-2alpha; AP2TF; BOFS; TFAP2
Exon (2)298..732
Gene:TFAP2A
Gene Synonym:AP-2; AP-2alpha; AP2TF; BOFS; TFAP2
Exon (3)733..784
Gene:TFAP2A
Gene Synonym:AP-2; AP-2alpha; AP2TF; BOFS; TFAP2
Exon (4)785..1016
Gene:TFAP2A
Gene Synonym:AP-2; AP-2alpha; AP2TF; BOFS; TFAP2
Exon (5)1017..1135
Gene:TFAP2A
Gene Synonym:AP-2; AP-2alpha; AP2TF; BOFS; TFAP2
Exon (6)1136..1277
Gene:TFAP2A
Gene Synonym:AP-2; AP-2alpha; AP2TF; BOFS; TFAP2
Exon (7)1278..3300
Gene:TFAP2A
Gene Synonym:AP-2; AP-2alpha; AP2TF; BOFS; TFAP2
Translation MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPP PYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSG LDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPV SLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSP PECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHL ARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLG NSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNS HTDNNAKSSDKEEKHRK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(27..38)-dbSNP:
complement(27..38)-, aagggcgaggagdbSNP:370163373
complement(110)-g, adbSNP:34658766
164+c, gdbSNP:1800927
complement(176)-c, adbSNP:374812295
211+a, cdbSNP:1139846
complement(225)-t, cdbSNP:373787155
complement(233)-g, cdbSNP:76066093
complement(276)-g, adbSNP:377304443
complement(311)-dbSNP:
complement(311)-c, adbSNP:143258135
complement(349)-t, cdbSNP:9368354
complement(376)-c, adbSNP:373246714
complement(387)-t, cdbSNP:149126243
complement(412..413)-, tdbSNP:34436436
complement(503)-g, adbSNP:200131527
complement(505)-g, cdbSNP:376101872
complement(549)-g, cdbSNP:372468982
complement(588)-t, cdbSNP:138225261
complement(624)-t, gdbSNP:145673154
complement(630)-g, cdbSNP:200574824
complement(671)-g, adbSNP:111353850
complement(672)-g, adbSNP:369051842
complement(714)-g, adbSNP:375321728
complement(743)-dbSNP:
complement(743)-t, cdbSNP:111681798
complement(800)-dbSNP:
complement(800)-t, gdbSNP:146735451
complement(808)-t, cdbSNP:201296512
complement(825)-g, adbSNP:143363077
complement(843)-t, cdbSNP:372587710
complement(875)-t, cdbSNP:202002859
complement(906)-g, adbSNP:369302647
961+c, gdbSNP:151344524
962+a, c, gdbSNP:151344525
complement(975)-t, g, cdbSNP:140905560
976+a, gdbSNP:151344526
complement(978)-t, cdbSNP:151009833
1004+a, gdbSNP:151344527
complement(1011)-g, cdbSNP:142511319
1012+c, g, tdbSNP:151344528
1013+c, gdbSNP:151344530
1015+a, gdbSNP:121909574
1019+dbSNP:
1019+c, tdbSNP:151344531
1037+a, gdbSNP:121909575
complement(1072)-g, adbSNP:35008125
1138+dbSNP:
1138+a, gdbSNP:267607108
complement(1164)-g, adbSNP:369463773
complement(1170)-g, adbSNP:141711078
complement(1171)-t, cdbSNP:377114324
complement(1184)-t, gdbSNP:144275164
1215+c, tdbSNP:1803117
complement(1299)-g, adbSNP:140377026
complement(1318)-g, cdbSNP:9350373
complement(1326)-g, adbSNP:375372321
complement(1362)-g, adbSNP:372082918
complement(1395)-g, adbSNP:372299435
complement(1431)-g, cdbSNP:181105841
1440+g, tdbSNP:2230116
complement(1440)-c, adbSNP:386443390
complement(1458)-g, cdbSNP:200847258
complement(1461)-g, adbSNP:201494266
complement(1508)-t, gdbSNP:201591227
1509+c, tdbSNP:3734391
1529+c, tdbSNP:1803116
complement(1548)-t, cdbSNP:374310228
complement(1590)-g, adbSNP:371339437
complement(1647)-g, adbSNP:369680359
complement(1654)-t, gdbSNP:10456013
complement(1693)-g, cdbSNP:188674648
1705+c, tdbSNP:1461010
complement(1863)-t, cdbSNP:118042860
complement(1889..1890)-, adbSNP:34512481
complement(1898..1899)-, adbSNP:111823522
complement(1903)-t, gdbSNP:2763172
complement(1908)-c, adbSNP:201528167
complement(1925..1927)-, ttgdbSNP:397885453
complement(1937..1939)-, ttgdbSNP:34426547
complement(1951)-g, adbSNP:9350372
2025+c, tdbSNP:151315569
complement(2079)-t, cdbSNP:146797011
2100+a, cdbSNP:1045385
complement(2179)-t, gdbSNP:184322632
complement(2216)-t, cdbSNP:201450721
2244+c, tdbSNP:75419063
complement(2294)-t, cdbSNP:181681871
complement(2305)-c, adbSNP:147713410
complement(2310)-t, cdbSNP:201819112
complement(2311..2312)-, adbSNP:397965898
complement(2312)-g, adbSNP:74636495
complement(2321..2322)-, adbSNP:61569279
complement(2322)-t, adbSNP:78186274
complement(2417)-c, adbSNP:3088288
complement(2421)-c, adbSNP:2763171
complement(2446)-c, adbSNP:115631304
complement(2491)-t, cdbSNP:2763170
complement(2510)-t, cdbSNP:113256477
complement(2521)-t, cdbSNP:185414193
2654+g, tdbSNP:2857059
2656+a, tdbSNP:2857060
complement(2675)-g, adbSNP:11553434
complement(2725)-t, cdbSNP:80094467
complement(2740)-g, adbSNP:193259940
complement(2755..2756)-, gadbSNP:150236619
complement(2793)-t, cdbSNP:2763169
complement(2880)-c, adbSNP:186469860
complement(2945)-, adbSNP:398094002
complement(2953)-, adbSNP:79168174
3089..3090+a, cdbSNP:2857061
complement(3089)-t, gdbSNP:2763168
complement(3190)-t, cdbSNP:16893358
complement(3216..3219)-, acaadbSNP:372257234
Gene SymbolTFAP2A
Gene SynonymAP-2; AP-2alpha; AP2TF; BOFS; TFAP2
Chromosome6
Locus Map6p24
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001032280 Homo sapiens transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_003220 Homo sapiens transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant 1, mRNA. On-demand $219.00 7-9
NM_001042425 Homo sapiens transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant 3, mRNA. On-demand $219.00 7-9
XM_006715175 PREDICTED: Homo sapiens transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant X1, mRNA. On-demand $219.00 7-9
Title High TFAP2C/low CD44 expression is associated with an increased rate of pathologic complete response following neoadjuvant chemotherapy in breast cancer .
Author Spanheimer PM, Askeland RW, Kulak MV, Wu T and Weigel RJ.
Journal J. Surg. Res. 184 (1), 519-525 (2013)
Title AP-2alpha suppresses invasion in BeWo cells by repression of matrix metalloproteinase-2 and -9 and up-regulation of E-cadherin .
Author Zhang Z, Zhang L, Jia L, Cui S, Shi Y, Chang A, Zeng X and Wang P.
Journal Mol. Cell. Biochem. 381 (1-2), 31-39 (2013)
Title Upregulation of Toll-like receptor 2 gene expression by acetylation of AP-2 alpha in THP-1 cells, a human monocytic cell line .
Author Li M, Li X, Wang E and Luo E.
Journal Int. J. Biochem. Cell Biol. 45 (8), 1594-1599 (2013)
Title Transcription factor AP-2alpha regulates acute myeloid leukemia cell proliferation by influencing Hoxa gene expression .
Author Ding X, Yang Z, Zhou F, Wang F, Li X, Chen C, Li X, Hu X, Xiang S and Zhang J.
Journal Int. J. Biochem. Cell Biol. 45 (8), 1647-1656 (2013)
Title Branchiooculofacial Syndrome .
Author Lin,A.E. and Milunsky,J.M.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Recognition sites for clathrin-associated proteins AP-2 and AP-3 on clathrin triskelia .
Author Murphy JE and Keen JH.
Journal J. Biol. Chem. 267 (15), 10850-10855 (1992)
Title Localization of the gene for the DNA-binding protein AP-2 to human chromosome 6p22.3-pter .
Author Gaynor RB, Muchardt C, Xia YR, Klisak I, Mohandas T, Sparkes RS and Lusis AJ.
Journal Genomics 10 (4), 1100-1102 (1991)
Title Analysis of the DNA-binding and activation properties of the human transcription factor AP-2 .
Author Williams T and Tjian R.
Journal Genes Dev. 5 (4), 670-682 (1991)
Title Characterization of a dimerization motif in AP-2 and its function in heterologous DNA-binding proteins .
Author Williams T and Tjian R.
Journal Science 251 (4997), 1067-1071 (1991)
Title Cloning and expression of AP-2, a cell-type-specific transcription factor that activates inducible enhancer elements .
Author Williams T, Admon A, Luscher B and Tjian R.
Journal Genes Dev. 2 (12A), 1557-1569 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.