• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens intercellular adhesion molecule 5, telencephalin (ICAM5), mRNA.


RefSeq Accession Definition Services Price Order
NM_003259 Homo sapiens intercellular adhesion molecule 5, telencephalin (ICAM5), mRNA. ORF Sequence $804.75
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_003259.3, 189571582
Length 3005 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens intercellular adhesion molecule 5, telencephalin (ICAM5), mRNA.
Product intercellular adhesion molecule 5 precursor
Comment

Summary: The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is expressed on the surface of telencephalic neurons and displays two types of adhesion activity, homophilic binding between neurons and heterophilic binding between neurons and leukocytes. It may be a critical component in neuron-microglial cell interactions in the course of normal development or as part of neurodegenerative diseases. [provided by RefSeq, Jul 2008].

RefSeq NP_003250.3
CDS 66..2840
Misc Feature(1)9..11
Misc Feature(2)9..11
Misc Feature(3)183..431
Misc Feature(4)423..722
Misc Feature(5)609..611
Misc Feature(6)615..617
Misc Feature(7)1035..1277
Misc Feature(8)1311..1526
Misc Feature(9)1560..1772
Misc Feature(10)<2202..2282
Misc Feature(11)2361..2549
Misc Feature(12)2571..2633
Exon (1)1..147
Gene:ICAM5
Gene Synonym:TLCN; TLN
Exon (2)148..417
Gene:ICAM5
Gene Synonym:TLCN; TLN
Exon (3)418..738
Gene:ICAM5
Gene Synonym:TLCN; TLN
Exon (4)739..1026
Gene:ICAM5
Gene Synonym:TLCN; TLN
Exon (5)1027..1281
Gene:ICAM5
Gene Synonym:TLCN; TLN
Exon (6)1282..1530
Gene:ICAM5
Gene Synonym:TLCN; TLN
Exon (7)1531..1776
Gene:ICAM5
Gene Synonym:TLCN; TLN
Exon (8)1777..2055
Gene:ICAM5
Gene Synonym:TLCN; TLN
Exon (9)2056..2295
Gene:ICAM5
Gene Synonym:TLCN; TLN
Exon (10)2296..2562
Gene:ICAM5
Gene Synonym:TLCN; TLN
Exon (11)2563..3002
Gene:ICAM5
Gene Synonym:TLCN; TLN
Translation MPGPSPGLRRALLGLWAALGLGLFGLSAVSQEPFWADLQPRVAFVERGGSLWLNCSTNCP RPERGGLETSLRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRP DRVELMPLPPWQPVGENFTLSCRVPGAGPRASLTLTLLRGAQELIRRSFAGEPPRARGAV LTATVLARREDHGANFSCRAELDLRPHGLGLFENSSAPRELRTFSLSPDAPRLAAPRLLE VGSERPVSCTLDGLFPASEARVYLALGDQNLSPDVTLEGDAFVATATATASAEQEGARQL VCNVTLGGENRETRENVTIYSFPAPLLTLSEPSVSEGQMVTVTCAAGAQALVTLEGVPAA VPGQPAQLQLNATENDDRRSFFCDATLDVDGETLIKNRSAELRVLYAPRLDDSDCPRSWT WPEGPEQTLRCEARGNPEPSVHCARSDGGAVLALGLLGPVTRALSGTYRCKAANDQGEAV KDVTLTVEYAPALDSVGCPERITWLEGTEASLSCVAHGVPPPDVICVRSGELGAVIEGLL RVAREHAGTYRCEATNPRGSAAKNVAVTVEYGPRFEEPSCPSNWTWVEGSGRLFSCEVDG KPQPSVKCVGSGGATEGVLLPLAPPDPSPRAPRIPRVLAPGIYVCNATNRHGSVAKTVVV SAESPPEMDESTCPSHQTWLEGAEASALACAARGRPSPGVRCSREGIPWPEQQRVSREDA GTYHCVATNAHGTDSRTVTVGVEYRPVVAELAASPPGGVRPGGNFTLTCRAEAWPPAQIS WRAPPGALNIGLSSNNSTLSVAGAMGSHGGEYECAATNAHGRHARRITVRVAGPWLWVAV GGAAGGAALLAAGAGLAFYVQSTACKKGEYNVQEAESSGEAVCLNGAGGGAGGAAGAEGG PEAAGGAAESPAEGEVFAIQLTSA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
27+c, tdbSNP:185076445
246+dbSNP:
246+c, tdbSNP:11669397
296+a, gdbSNP:56406350
337+c, gdbSNP:149309075
422+dbSNP:
422+a, gdbSNP:201752473
449+a, gdbSNP:200293534
560+a, cdbSNP:199738344
591..592+, gcdbSNP:34562857
632+a, gdbSNP:143556346
635+a, gdbSNP:148312881
672..673+, cdbSNP:35701141
683+g, tdbSNP:115870389
748+dbSNP:
748+c, tdbSNP:147452916
766+c, tdbSNP:139899408
921..922+, cdbSNP:141991245
966+c, tdbSNP:1056538
1005+a, cdbSNP:150703171
1052+dbSNP:
1052+c, gdbSNP:139993605
1060+c, gdbSNP:114980880
1098+a, gdbSNP:145824055
1107+a, gdbSNP:2228615
1184+c, gdbSNP:144063436
1260+a, gdbSNP:146416564
1272+a, cdbSNP:140852122
1396+dbSNP:
1396+c, tdbSNP:202091893
1420+c, tdbSNP:143181516
1423+c, tdbSNP:200758108
1452+a, gdbSNP:151211439
1476+a, cdbSNP:140395213
1486+a, gdbSNP:201216338
1518+c, tdbSNP:150342965
1551+dbSNP:
1551+a, gdbSNP:10418913
1609+a, tdbSNP:200251866
1628+a, gdbSNP:199664255
1662+a, gdbSNP:201577589
1676+a, gdbSNP:17852402
1687+c, gdbSNP:147074144
1738+a, gdbSNP:147604357
1745+c, tdbSNP:116688659
1769+a, gdbSNP:36045754
1811+dbSNP:
1811+c, tdbSNP:144234155
1820+a, gdbSNP:148788922
1840+a, gdbSNP:200192686
1905+c, tdbSNP:1056536
1928+g, tdbSNP:141583702
2049+a, gdbSNP:200000538
2051+a, gdbSNP:180744933
2101+dbSNP:
2101+c, gdbSNP:201933364
2164+c, tdbSNP:111983057
2184+a, cdbSNP:200968160
2263+a, cdbSNP:150873217
2299+dbSNP:
2299+a, gdbSNP:111584571
2378+a, gdbSNP:35318566
2421+a, gdbSNP:2569706
2471..2472+, gdbSNP:139617839
2511+c, gdbSNP:2569707
2512+c, gdbSNP:2735441
2717+dbSNP:
2717+c, gdbSNP:710845
2769+c, gdbSNP:1529739
2834+g, tdbSNP:188344435
2971+c, gdbSNP:2569709
2986+a, gdbSNP:2569710
2996+a, gdbSNP:2735443
Gene SymbolICAM5
Gene SynonymTLCN; TLN
Chromosome19
Locus Map19p13.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_003259 Homo sapiens intercellular adhesion molecule 5, telencephalin (ICAM5), mRNA. Full Length $1051.75
ORF Sequence $804.75
Title ARF6-mediated endosomal transport of Telencephalin affects dendritic filopodia-to-spine maturation .
Author Raemaekers,T., Peric,A., Baatsen,P., Sannerud,R., Declerck,I., Baert,V., Michiels,C. and Annaert,W.
Journal EMBO J. 31 (15), 3252-3269 (2012)
Title A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer .
Author Ho-Pun-Cheung,A., Assenat,E., Bascoul-Mollevi,C., Bibeau,F., Boissiere-Michot,F., Thezenas,S., Cellier,D., Azria,D., Rouanet,P., Senesse,P., Ychou,M. and Lopez-Crapez,E.
Journal Pharmacogenomics J. 11 (6), 437-443 (2011)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut .
Author Lee,K.M., Baris,D., Zhang,Y., Hosgood,H.D. III, Menashe,I., Yeager,M., Zahm,S.H., Wang,S.S., Purdue,M.P., Chanock,S., Zheng,T., Rothman,N. and Lan,Q.
Journal Am. J. Hematol. 85 (8), 560-563 (2010)
Title Polymorphisms in innate immunity genes and risk of childhood leukemia .
Author Han,S., Lan,Q., Park,A.K., Lee,K.M., Park,S.K., Ahn,H.S., Shin,H.Y., Kang,H.J., Koo,H.H., Seo,J.J., Choi,J.E., Ahn,Y.O., Chanock,S.J., Kim,H., Rothman,N. and Kang,D.
Journal Hum. Immunol. 71 (7), 727-730 (2010)
Title Telencephalin as an indicator for temporal-lobe dysfunction .
Author Rieckmann,P., Turner,T., Kligannon,P. and Steinhoff,B.J.
Journal Lancet 352 (9125), 370-371 (1998)
Title Polarized distribution and cell type-specific localization of telencephalin, an intercellular adhesion molecule .
Author Benson,D.L., Yoshihara,Y. and Mori,K.
Journal J. Neurosci. Res. 52 (1), 43-53 (1998)
Title The intercellular adhesion molecule (ICAM) family of proteins. New members and novel functions .
Author Hayflick,J.S., Kilgannon,P. and Gallatin,W.M.
Journal Immunol. Res. 17 (3), 313-327 (1998)
Title cDNA cloning and chromosomal localization of the human telencephalin and its distinctive interaction with lymphocyte function-associated antigen-1 .
Author Mizuno,T., Yoshihara,Y., Inazawa,J., Kagamiyama,H. and Mori,K.
Journal J. Biol. Chem. 272 (2), 1156-1163 (1997)
Title Telencephalin: a neuronal area code molecule? .
Author Yoshihara,Y. and Mori,K.
Journal Neurosci. Res. 21 (2), 119-124 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878