Homo sapiens intercellular adhesion molecule 5, telencephalin (ICAM5), mRNA.
| RefSeq Version | NM_003259.3, 189571582 |
| Length | 3005 bp |
| Structure | linear |
| Update Date | 12-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens intercellular adhesion molecule 5, telencephalin (ICAM5), mRNA. |
| Product | intercellular adhesion molecule 5 precursor |
| Comment | Summary: The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is expressed on the surface of telencephalic neurons and displays two types of adhesion activity, homophilic binding between neurons and heterophilic binding between neurons and leukocytes. It may be a critical component in neuron-microglial cell interactions in the course of normal development or as part of neurodegenerative diseases. [provided by RefSeq]. |
| RefSeq | NP_003250.3 |
| CDS | 66..2840 | Exon (1) | 1..147 | Exon (2) | 1..147 | Exon (3) | 148..417 | Exon (4) | 418..738 | Exon (5) | 739..1026 | Exon (6) | 1027..1281 | Exon (7) | 1282..1530 | Exon (8) | 1531..1776 | Exon (9) | 1777..2055 | Exon (10) | 2056..2295 | Exon (11) | 2296..2562 | Exon (12) | 2563..3002 |
| Translation | MPGPSPGLRRALLGLWAALGLGLFGLSAVSQEPFWADLQPRVAFVERGGSLWLNCSTNCP
RPERGGLETSLRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRP
DRVELMPLPPWQPVGENFTLSCRVPGAGPRASLTLTLLRGAQELIRRSFAGEPPRARGAV
LTATVLARREDHGANFSCRAELDLRPHGLGLFENSSAPRELRTFSLSPDAPRLAAPRLLE
VGSERPVSCTLDGLFPASEARVYLALGDQNLSPDVTLEGDAFVATATATASAEQEGARQL
VCNVTLGGENRETRENVTIYSFPAPLLTLSEPSVSEGQMVTVTCAAGAQALVTLEGVPAA
VPGQPAQLQLNATENDDRRSFFCDATLDVDGETLIKNRSAELRVLYAPRLDDSDCPRSWT
WPEGPEQTLRCEARGNPEPSVHCARSDGGAVLALGLLGPVTRALSGTYRCKAANDQGEAV
KDVTLTVEYAPALDSVGCPERITWLEGTEASLSCVAHGVPPPDVICVRSGELGAVIEGLL
RVAREHAGTYRCEATNPRGSAAKNVAVTVEYGPRFEEPSCPSNWTWVEGSGRLFSCEVDG
KPQPSVKCVGSGGATEGVLLPLAPPDPSPRAPRIPRVLAPGIYVCNATNRHGSVAKTVVV
SAESPPEMDESTCPSHQTWLEGAEASALACAARGRPSPGVRCSREGIPWPEQQRVSREDA
GTYHCVATNAHGTDSRTVTVGVEYRPVVAELAASPPGGVRPGGNFTLTCRAEAWPPAQIS
WRAPPGALNIGLSSNNSTLSVAGAMGSHGGEYECAATNAHGRHARRITVRVAGPWLWVAV
GGAAGGAALLAAGAGLAFYVQSTACKKGEYNVQEAESSGEAVCLNGAGGGAGGAAGAEGG
PEAAGGAAESPAEGEVFAIQLTSA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 246 | + | c, t | dbSNP:11669397 |
| 296 | + | a, g | dbSNP:56406350 |
| 591..592 | + | , gc | dbSNP:34562857 |
| 672..673 | + | , c | dbSNP:35701141 |
| 683 | + | g, t | dbSNP:115870389 |
| complement(966) | - | t, c | dbSNP:1056538 |
| 1060 | + | c, g | dbSNP:114980880 |
| 1107 | + | a, g | dbSNP:2228615 |
| 1551 | + | a, g | dbSNP:10418913 |
| 1676 | + | a, g | dbSNP:17852402 |
| 1745 | + | c, t | dbSNP:116688659 |
| 1769 | + | a, g | dbSNP:36045754 |
| complement(1905) | - | t, c | dbSNP:1056536 |
| 2164 | + | c, t | dbSNP:111983057 |
| 2299 | + | a, g | dbSNP:111584571 |
| 2378 | + | a, g | dbSNP:35318566 |
| 2421 | + | a, g | dbSNP:2569706 |
| 2511 | + | c, g | dbSNP:2569707 |
| 2512 | + | c, g | dbSNP:2735441 |
| 2717 | + | c, g | dbSNP:710845 |
| 2769 | + | c, g | dbSNP:1529739 |
| 2971 | + | c, g | dbSNP:2569709 |
| 2986 | + | a, g | dbSNP:2569710 |
| 2996 | + | a, g | dbSNP:2735443 |
| Title | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study . |
| Author | Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S. |
| Journal | Diabetes Care 33 (10), 2250-2253 (2010) |
| Title | Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut . |
| Author | Lee,K.M., Baris,D., Zhang,Y., Hosgood,H.D. III, Menashe,I., Yeager,M., Zahm,S.H., Wang,S.S., Purdue,M.P., Chanock,S., Zheng,T., Rothman,N. and Lan,Q. |
| Journal | Am. J. Hematol. 85 (8), 560-563 (2010) |
| Title | A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer . |
| Author | Ho-Pun-Cheung,A., Assenat,E., Bascoul-Mollevi,C., Bibeau,F., Boissiere-Michot,F., Thezenas,S., Cellier,D., Azria,D., Rouanet,P., Senesse,P., Ychou,M. and Lopez-Crapez,E. |
| Journal | Pharmacogenomics J. (2010) In press |
| Title | Polymorphisms in innate immunity genes and risk of childhood leukemia . |
| Author | Han,S., Lan,Q., Park,A.K., Lee,K.M., Park,S.K., Ahn,H.S., Shin,H.Y., Kang,H.J., Koo,H.H., Seo,J.J., Choi,J.E., Ahn,Y.O., Chanock,S.J., Kim,H., Rothman,N. and Kang,D. |
| Journal | Hum. Immunol. 71 (7), 727-730 (2010) |
| Title | Risk of meningioma and common variation in genes related to innate immunity . |
| Author | Rajaraman,P., Brenner,A.V., Neta,G., Pfeiffer,R., Wang,S.S., Yeager,M., Thomas,G., Fine,H.A., Linet,M.S., Rothman,N., Chanock,S.J. and Inskip,P.D. |
| Journal | Cancer Epidemiol. Biomarkers Prev. 19 (5), 1356-1361 (2010) |
| Title | Telencephalin as an indicator for temporal-lobe dysfunction . |
| Author | Rieckmann,P., Turner,T., Kligannon,P. and Steinhoff,B.J. |
| Journal | Lancet 352 (9125), 370-371 (1998) |
| Title | Polarized distribution and cell type-specific localization of telencephalin, an intercellular adhesion molecule . |
| Author | Benson,D.L., Yoshihara,Y. and Mori,K. |
| Journal | J. Neurosci. Res. 52 (1), 43-53 (1998) |
| Title | The intercellular adhesion molecule (ICAM) family of proteins. New members and novel functions . |
| Author | Hayflick,J.S., Kilgannon,P. and Gallatin,W.M. |
| Journal | Immunol. Res. 17 (3), 313-327 (1998) |
| Title | cDNA cloning and chromosomal localization of the human telencephalin and its distinctive interaction with lymphocyte function-associated antigen-1 . |
| Author | Mizuno,T., Yoshihara,Y., Inazawa,J., Kagamiyama,H. and Mori,K. |
| Journal | J. Biol. Chem. 272 (2), 1156-1163 (1997) |
| Title | Telencephalin: a neuronal area code molecule? . |
| Author | Yoshihara,Y. and Mori,K. |
| Journal | Neurosci. Res. 21 (2), 119-124 (1994) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |