• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens toll-like receptor 1 (TLR1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003263 Homo sapiens toll-like receptor 1 (TLR1), mRNA. GenEZ ORF Cloning In-stock $809.00 $760.00 15

*Business Day

Related Services

RefSeq Version NM_003263.3, 41350336
Length 2867 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens toll-like receptor 1 (TLR1), mRNA.
Product toll-like receptor 1
Comment

Summary: The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is ubiquitously expressed, and at higher levels than other TLR genes. Different length transcripts presumably resulting from use of alternative polyadenylation site, and/or from alternative splicing, have been noted for this gene. [provided by RefSeq, Jul 2008].

RefSeq NP_003254.2
CDS 275..2635
Misc Feature(1)263..265
Misc Feature(2)263..265
Misc Feature(3)434..505
Misc Feature(4)434..505
Misc Feature(5)506..577
Misc Feature(6)557..727
Misc Feature(7)578..649
Misc Feature(8)650..724
Misc Feature(9)725..799
Misc Feature(10)800..871
Misc Feature(11)872..943
Misc Feature(12)944..1024
Misc Feature(13)1025..1108
Misc Feature(14)1109..1198
Misc Feature(15)1199..1285
Misc Feature(16)1211..1222
Misc Feature(17)1286..1357
Misc Feature(18)1328..1501
Misc Feature(19)1358..1438
Misc Feature(20)1439..1516
Misc Feature(21)1517..1585
Misc Feature(22)1586..1645
Misc Feature(23)1610..1777
Misc Feature(24)1646..1708
Misc Feature(25)1709..1774
Misc Feature(26)1775..1846
Misc Feature(27)1844..2005
Misc Feature(28)2015..2077
Misc Feature(29)2180..2611
Exon (1)1..38
Gene:TLR1
Gene Synonym:CD281; rsc786; TIL; TIL. LPRS5
Exon (2)39..115
Gene:TLR1
Gene Synonym:CD281; rsc786; TIL; TIL. LPRS5
Exon (3)116..207
Gene:TLR1
Gene Synonym:CD281; rsc786; TIL; TIL. LPRS5
Exon (4)208..2851
Gene:TLR1
Gene Synonym:CD281; rsc786; TIL; TIL. LPRS5
Translation MTSIFHFAIIFMLILQIRIQLSEESEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISEL WTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLD LSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKED PEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKL QTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLK ALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLL TDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS WTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSL TDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNID QVSSEVLEGWPDSYKCDYPESYRGTLLKDFHMSELSCNITLLIVTIVATMLVLAVTVTSL CSYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSGHDSFWVKNELLPNLE KEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFH EGSNSLILILLEPIPQYSIPSSYHKLKSLMARRTYLEWPKEKSKRGLFWANLRAAINIKL TEQAKK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(47)-dbSNP:
complement(47)-t, gdbSNP:138668533
complement(49)-t, cdbSNP:193037370
complement(59)-g, adbSNP:5743565
complement(83)-t, cdbSNP:145843781
complement(100)-g, cdbSNP:5743566
complement(128)-dbSNP:
complement(128)-g, adbSNP:113956629
complement(157)-t, cdbSNP:5743596
complement(307)-g, adbSNP:140743873
complement(310)-t, cdbSNP:201961218
complement(324)-t, adbSNP:147564337
complement(330)-c, adbSNP:200508559
complement(358)-t, cdbSNP:146944139
complement(365)-t, cdbSNP:140255888
complement(376)-g, adbSNP:200178542
complement(388)-t, cdbSNP:5743610
complement(389)-t, cdbSNP:143455657
complement(404)-g, adbSNP:76600635
complement(419)-t, cdbSNP:181364215
complement(433)-g, adbSNP:55851227
complement(445)-t, cdbSNP:145135062
complement(468)-c, adbSNP:149960231
complement(498)-t, cdbSNP:137853170
complement(513)-g, cdbSNP:5743611
complement(550)-g, adbSNP:146309534
complement(575)-g, adbSNP:200212492
complement(587)-g, adbSNP:112240105
complement(596)-t, adbSNP:200474947
complement(607)-g, adbSNP:142004445
complement(626)-t, cdbSNP:5743612
complement(638)-c, adbSNP:146114753
complement(644)-t, cdbSNP:190177710
complement(668)-g, c, adbSNP:141970382
complement(675)-t, adbSNP:13152776
complement(705)-g, adbSNP:117033348
complement(707)-g, cdbSNP:201998340
complement(770)-t, adbSNP:148163826
complement(782)-g, cdbSNP:144817025
complement(784)-g, adbSNP:149430939
complement(812)-g, cdbSNP:185331480
complement(865)-, cdbSNP:56043098
complement(894)-t, gdbSNP:137873769
complement(935)-t, adbSNP:202092369
complement(988)-t, cdbSNP:146940675
complement(1017)-t, cdbSNP:4833095
complement(1089)-g, cdbSNP:200269582
complement(1093)-t, cdbSNP:138773657
complement(1115)-t, cdbSNP:201490388
complement(1167)-g, adbSNP:150138583
complement(1188)-t, adbSNP:3923647
complement(1211)-t, cdbSNP:150985008
complement(1218)-t, cdbSNP:5743613
complement(1219)-t, cdbSNP:185747096
complement(1222)-t, cdbSNP:140421533
complement(1231)-g, adbSNP:146782074
complement(1234)-g, adbSNP:200631178
complement(1245)-t, g, adbSNP:143619350
complement(1246)-t, cdbSNP:140075350
complement(1278)-g, cdbSNP:141091142
complement(1283)-g, adbSNP:200457447
complement(1318)-t, gdbSNP:200829133
complement(1328)-t, gdbSNP:76796448
complement(1355)-t, adbSNP:189308820
complement(1362)-g, adbSNP:184548723
complement(1375)-g, adbSNP:146527690
complement(1385)-g, adbSNP:201398822
complement(1412)-g, adbSNP:200264939
complement(1430)-t, c, adbSNP:150011580
complement(1436)-g, adbSNP:200988873
complement(1444)-t, cdbSNP:192055114
complement(1463)-t, cdbSNP:111596029
complement(1480)-t, cdbSNP:187241225
complement(1502)-t, cdbSNP:139333505
complement(1524)-c, adbSNP:184834731
complement(1540)-g, adbSNP:201868639
complement(1601)-t, c, adbSNP:199899599
complement(1649)-t, cdbSNP:201596172
complement(1650)-t, cdbSNP:150883098
complement(1652)-g, adbSNP:137853171
complement(1666)-g, adbSNP:201013197
complement(1667)-t, cdbSNP:200070488
complement(1679)-t, cdbSNP:201964388
complement(1680)-g, adbSNP:141556246
complement(1704)-c, adbSNP:200656244
complement(1756)-t, cdbSNP:143576719
complement(1792)-g, adbSNP:5743614
complement(1814)-g, adbSNP:200594956
complement(1825)-c, adbSNP:199539854
complement(1837)-t, gdbSNP:192439045
complement(1838)-g, cdbSNP:187823248
complement(1851)-c, adbSNP:201271982
complement(1856)-c, adbSNP:200607815
complement(1858)-t, cdbSNP:5743615
complement(1871)-t, cdbSNP:200506989
complement(1899)-t, cdbSNP:137853172
complement(1935)-g, adbSNP:137853173
complement(1951)-g, adbSNP:5743616
complement(1968)-g, cdbSNP:149065118
complement(1986)-t, cdbSNP:112542063
complement(2007)-t, g, cdbSNP:138016555
complement(2025)-g, adbSNP:150358789
complement(2032)-g, adbSNP:140382462
complement(2034)-t, gdbSNP:5743617
complement(2064)-g, adbSNP:111807776
complement(2070)-g, adbSNP:143576765
complement(2079)-t, gdbSNP:5743618
complement(2087)-c, adbSNP:151036585
complement(2120)-t, adbSNP:142855687
complement(2131)-g, adbSNP:148537628
complement(2132)-t, gdbSNP:144775976
complement(2133)-t, cdbSNP:201366752
complement(2136)-t, cdbSNP:200088165
complement(2147)-t, adbSNP:202172776
complement(2166)-t, gdbSNP:5743619
complement(2176)-g, adbSNP:190895342
complement(2188)-g, adbSNP:200912870
complement(2212)-g, adbSNP:72493538
complement(2226)-t, cdbSNP:137853174
complement(2242)-g, adbSNP:5743620
complement(2246)-t, gdbSNP:140268578
complement(2282)-t, cdbSNP:138709743
complement(2294)-g, adbSNP:137853175
complement(2302)-g, adbSNP:41311400
complement(2305)-g, cdbSNP:148014858
complement(2310)-t, cdbSNP:56205407
complement(2316)-t, gdbSNP:201743225
complement(2328)-t, gdbSNP:187624160
complement(2340)-t, cdbSNP:143548463
complement(2364)-g, adbSNP:41311402
complement(2391)-t, cdbSNP:143251194
complement(2410)-t, gdbSNP:141789763
complement(2424)-t, cdbSNP:201148050
complement(2433)-c, adbSNP:113706342
complement(2472)-t, cdbSNP:5743621
complement(2474)-t, cdbSNP:141132868
complement(2479)-c, adbSNP:145159325
complement(2485)-g, adbSNP:145802478
complement(2492)-g, adbSNP:41305843
complement(2503)-g, adbSNP:200811735
complement(2509)-c, adbSNP:140497916
complement(2580)-t, cdbSNP:200356797
complement(2613)-g, adbSNP:151285692
complement(2617)-t, cdbSNP:144733677
complement(2638)-c, adbSNP:201203468
complement(2743)-t, gdbSNP:56217454
complement(2770)-g, adbSNP:147339251
complement(2799)-g, adbSNP:5743622
complement(2851)-g, adbSNP:4624663
Gene SymbolTLR1
Gene SynonymCD281; rsc786; TIL; TIL. LPRS5
Chromosome4
Locus Map4p14
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003263 Homo sapiens toll-like receptor 1 (TLR1), mRNA. In-stock $809.00 $760.00 15
Title Racial variation in toll-like receptor variants among women with pelvic inflammatory disease .
Author Taylor,B.D., Darville,T., Ferrell,R.E., Ness,R.B. and Haggerty,C.L.
Journal J. Infect. Dis. 207 (6), 940-946 (2013)
Title Toll-like receptor gene polymorphisms confer susceptibility to graft-versus-host disease in allogenic hematopoietic stem cell transplantation .
Author Sivula,J., Cordova,Z.M., Tuimala,J., Jaatinen,T., Partanen,J., Volin,L. and Turpeinen,H.
Journal Scand. J. Immunol. 76 (3), 336-341 (2012)
Title Soluble Toll-like receptor 1 family members in the amniotic fluid of women with preterm prelabor rupture of the membranes .
Author Kacerovsky,M., Andrys,C., Drahosova,M., Musilova,I., Hornychova,H., Lesko,D., Tosner,J. and Jacobsson,B.
Journal J. Matern. Fetal. Neonatal. Med. 25 (9), 1699-1704 (2012)
Title Cell surface trafficking of TLR1 is differentially regulated by the chaperones PRAT4A and PRAT4B .
Author Hart,B.E. and Tapping,R.I.
Journal J. Biol. Chem. 287 (20), 16550-16562 (2012)
Title Toll-like receptor 1 polymorphisms increase susceptibility to candidemia .
Author Plantinga,T.S., Johnson,M.D., Scott,W.K., van de Vosse,E., Velez Edwards,D.R., Smith,P.B., Alexander,B.D., Yang,J.C., Kremer,D., Laird,G.M., Oosting,M., Joosten,L.A., van der Meer,J.W., van Dissel,J.T., Walsh,T.J., Perfect,J.R., Kullberg,B.J. and Netea,M.G.
Journal J. Infect. Dis. 205 (6), 934-943 (2012)
Title Structural basis for signal transduction by the Toll/interleukin-1 receptor domains .
Author Xu,Y., Tao,X., Shen,B., Horng,T., Medzhitov,R., Manley,J.L. and Tong,L.
Journal Nature 408 (6808), 111-115 (2000)
Title Differential expression and regulation of toll-like receptors (TLR) in human leukocytes: selective expression of TLR3 in dendritic cells .
Author Muzio,M., Bosisio,D., Polentarutti,N., D'amico,G., Stoppacciaro,A., Mancinelli,R., van't Veer,C., Penton-Rol,G., Ruco,L.P., Allavena,P. and Mantovani,A.
Journal J. Immunol. 164 (11), 5998-6004 (2000)
Title Host defense mechanisms triggered by microbial lipoproteins through toll-like receptors .
Author Brightbill,H.D., Libraty,D.H., Krutzik,S.R., Yang,R.B., Belisle,J.T., Bleharski,J.R., Maitland,M., Norgard,M.V., Plevy,S.E., Smale,S.T., Brennan,P.J., Bloom,B.R., Godowski,P.J. and Modlin,R.L.
Journal Science 285 (5428), 732-736 (1999)
Title A family of human receptors structurally related to Drosophila Toll .
Author Rock,F.L., Hardiman,G., Timans,J.C., Kastelein,R.A. and Bazan,J.F.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (2), 588-593 (1998)
Title Chromosomal localization of TIL, a gene encoding a protein related to the Drosophila transmembrane receptor Toll, to human chromosome 4p14 .
Author Taguchi,T., Mitcham,J.L., Dower,S.K., Sims,J.E. and Testa,J.R.
Journal Genomics 32 (3), 486-488 (1996)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.