• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens toll-like receptor 1 (TLR1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19306 Homo sapiens toll-like receptor 1 (TLR1), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu19306C Homo sapiens toll-like receptor 1 (TLR1), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_003263.3, 41350336
Length 2361 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens toll-like receptor 1 (TLR1), mRNA.
Product toll-like receptor 1 precursor
Comment

Summary: The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is ubiquitously expressed, and at higher levels than other TLR genes. Different length transcripts presumably resulting from use of alternative polyadenylation site, and/or from alternative splicing, have been noted for this gene. [provided by RefSeq, Jul 2008].

RefSeq NP_003254.2
CDS 275..2635
Misc Feature(1)263..265
Misc Feature(2)263..265
Misc Feature(3)434..505
Misc Feature(4)479..646
Misc Feature(5)482..601
Misc Feature(6)506..577
Misc Feature(7)578..649
Misc Feature(8)650..724
Misc Feature(9)725..799
Misc Feature(10)800..871
Misc Feature(11)872..943
Misc Feature(12)944..1024
Misc Feature(13)1025..1108
Misc Feature(14)1109..1198
Misc Feature(15)1199..1285
Misc Feature(16)1211..1222
Misc Feature(17)1286..1357
Misc Feature(18)<1331..1696
Misc Feature(19)order(1343..1345,1493..1495,1559..1561,1565..1567,
Misc Feature(20)1358..1438
Misc Feature(21)1439..1516
Misc Feature(22)1517..1585
Misc Feature(23)1586..1645
Misc Feature(24)1607..1777
Misc Feature(25)1646..1708
Misc Feature(26)1709..1774
Misc Feature(27)1775..1846
Misc Feature(28)1844..2005
Misc Feature(29)2015..2077
Misc Feature(30)2180..2611
Exon (1)1..38
Gene:TLR1
Gene Synonym:CD281; rsc786; TIL; TIL. LPRS5
Exon (2)39..115
Gene:TLR1
Gene Synonym:CD281; rsc786; TIL; TIL. LPRS5
Exon (3)116..207
Gene:TLR1
Gene Synonym:CD281; rsc786; TIL; TIL. LPRS5
Exon (4)208..2851
Gene:TLR1
Gene Synonym:CD281; rsc786; TIL; TIL. LPRS5
Translation MTSIFHFAIIFMLILQIRIQLSEESEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISEL WTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLD LSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKED PEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKL QTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLK ALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLL TDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS WTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSL TDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNID QVSSEVLEGWPDSYKCDYPESYRGTLLKDFHMSELSCNITLLIVTIVATMLVLAVTVTSL CSYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSGHDSFWVKNELLPNLE KEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFH EGSNSLILILLEPIPQYSIPSSYHKLKSLMARRTYLEWPKEKSKRGLFWANLRAAINIKL TEQAKK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(47)-dbSNP:
complement(47)-t, gdbSNP:138668533
complement(49)-t, cdbSNP:193037370
59+a, gdbSNP:5743565
complement(83)-t, cdbSNP:145843781
100+c, gdbSNP:5743566
complement(128)-dbSNP:
complement(128)-g, adbSNP:113956629
157+c, tdbSNP:5743596
complement(157)-g, adbSNP:386599638
complement(188)-g, adbSNP:374772817
complement(307)-g, adbSNP:140743873
complement(310)-t, cdbSNP:201961218
complement(324)-t, adbSNP:147564337
complement(330)-c, adbSNP:200508559
complement(358)-t, cdbSNP:146944139
complement(365)-t, cdbSNP:140255888
complement(376)-g, adbSNP:200178542
388+c, tdbSNP:5743610
complement(389)-t, cdbSNP:143455657
complement(404)-g, adbSNP:76600635
complement(419)-t, cdbSNP:181364215
complement(432)-g, adbSNP:368957715
433+a, gdbSNP:55851227
complement(445)-t, cdbSNP:145135062
complement(468)-c, adbSNP:149960231
498+c, tdbSNP:137853170
513+c, gdbSNP:5743611
complement(550)-g, adbSNP:146309534
complement(575)-g, adbSNP:200212492
complement(587)-g, adbSNP:112240105
complement(596)-t, adbSNP:200474947
complement(607)-g, adbSNP:142004445
626+c, tdbSNP:5743612
complement(638)-c, adbSNP:146114753
complement(639)-g, adbSNP:374676728
complement(644)-t, cdbSNP:190177710
complement(668)-g, c, adbSNP:141970382
complement(675)-t, c, adbSNP:13152776
complement(690)-t, gdbSNP:368672305
complement(705)-g, adbSNP:117033348
complement(705)-g, adbSNP:386452081
complement(707)-g, cdbSNP:201998340
complement(770)-t, adbSNP:148163826
complement(782)-g, cdbSNP:144817025
complement(812)-g, cdbSNP:185331480
865+, cdbSNP:56043098
complement(878)-g, adbSNP:373908427
complement(894)-t, gdbSNP:137873769
complement(902)-t, cdbSNP:372216793
complement(935)-t, adbSNP:202092369
complement(988)-t, cdbSNP:146940675
complement(1017)-t, cdbSNP:4833095
complement(1069)-g, adbSNP:368036827
complement(1075)-c, adbSNP:374742061
complement(1089)-g, cdbSNP:200269582
complement(1093)-t, cdbSNP:138773657
complement(1115)-t, cdbSNP:201490388
complement(1126)-g, cdbSNP:370332202
complement(1167)-g, adbSNP:150138583
complement(1188)-t, adbSNP:3923647
complement(1211)-t, cdbSNP:150985008
1218+c, tdbSNP:5743613
complement(1219)-t, cdbSNP:185747096
complement(1222)-t, cdbSNP:140421533
complement(1231)-g, adbSNP:146782074
complement(1234)-g, adbSNP:200631178
complement(1245)-t, g, adbSNP:143619350
complement(1246)-t, cdbSNP:140075350
complement(1249)-g, adbSNP:370738284
complement(1278)-g, cdbSNP:141091142
complement(1283)-g, adbSNP:200457447
complement(1284)-t, cdbSNP:375985007
complement(1314)-g, adbSNP:372400514
complement(1318)-t, gdbSNP:200829133
complement(1321)-t, cdbSNP:375416156
complement(1328)-t, gdbSNP:76796448
complement(1355)-t, adbSNP:189308820
complement(1362)-g, adbSNP:184548723
complement(1375)-g, adbSNP:146527690
complement(1385)-g, adbSNP:201398822
complement(1412)-g, adbSNP:200264939
complement(1430)-t, c, adbSNP:150011580
complement(1436)-g, adbSNP:200988873
complement(1444)-t, cdbSNP:192055114
complement(1463)-t, cdbSNP:111596029
complement(1467)-t, cdbSNP:369552054
complement(1480)-t, cdbSNP:187241225
complement(1502)-t, cdbSNP:139333505
complement(1514)-c, adbSNP:370650514
complement(1524)-c, adbSNP:184834731
complement(1540)-g, adbSNP:201868639
complement(1562)-t, cdbSNP:367870740
complement(1594)-g, adbSNP:375406105
complement(1601)-t, c, adbSNP:199899599
complement(1637)-t, cdbSNP:371397631
complement(1649)-t, cdbSNP:201596172
1652+a, gdbSNP:137853171
complement(1666)-g, adbSNP:201013197
complement(1667)-t, cdbSNP:200070488
complement(1679)-t, cdbSNP:201964388
complement(1680)-g, adbSNP:141556246
complement(1695)-t, cdbSNP:374992283
complement(1704)-c, adbSNP:200656244
complement(1746)-t, cdbSNP:370784389
complement(1748)-g, adbSNP:375952631
complement(1756)-t, cdbSNP:143576719
1792+a, gdbSNP:5743614
complement(1814)-g, adbSNP:200594956
complement(1825)-c, adbSNP:199539854
complement(1837)-t, gdbSNP:192439045
complement(1838)-g, cdbSNP:187823248
complement(1839)-g, cdbSNP:368881067
complement(1851)-c, adbSNP:201271982
complement(1856)-c, adbSNP:200607815
1858+c, tdbSNP:5743615
complement(1860)-g, adbSNP:377068130
complement(1871)-t, cdbSNP:200506989
1899+c, tdbSNP:137853172
1935+a, gdbSNP:137853173
1951+a, gdbSNP:5743616
complement(1964)-t, cdbSNP:372658963
complement(1968)-g, cdbSNP:149065118
complement(1986)-t, cdbSNP:112542063
complement(2007)-t, g, cdbSNP:138016555
complement(2025)-g, adbSNP:150358789
complement(2032)-g, adbSNP:140382462
complement(2033)-t, cdbSNP:370009768
2034+g, tdbSNP:5743617
complement(2038)-g, adbSNP:375868027
complement(2064)-g, adbSNP:111807776
complement(2070)-g, adbSNP:143576765
complement(2076)-c, adbSNP:374121599
complement(2079)-t, gdbSNP:76798247
2079+g, tdbSNP:5743618
complement(2087)-c, adbSNP:151036585
complement(2120)-t, adbSNP:142855687
complement(2131)-g, adbSNP:148537628
complement(2132)-t, gdbSNP:144775976
complement(2133)-t, cdbSNP:201366752
complement(2135)-g, adbSNP:369737596
complement(2136)-t, cdbSNP:200088165
complement(2147)-t, adbSNP:202172776
2166+g, tdbSNP:5743619
complement(2166)-c, adbSNP:386599639
complement(2176)-g, adbSNP:190895342
complement(2188)-g, adbSNP:200912870
complement(2200)-t, cdbSNP:372081210
complement(2212)-g, adbSNP:72493538
2226+c, tdbSNP:137853174
2242+a, gdbSNP:5743620
complement(2246)-t, gdbSNP:140268578
complement(2282)-t, cdbSNP:138709743
2294+a, gdbSNP:137853175
complement(2299)-g, adbSNP:372163988
complement(2302)-g, adbSNP:41311400
complement(2305)-g, cdbSNP:148014858
2310+c, tdbSNP:56205407
complement(2316)-t, gdbSNP:201743225
complement(2328)-t, gdbSNP:187624160
complement(2340)-t, cdbSNP:143548463
complement(2364)-g, adbSNP:41311402
complement(2391)-t, cdbSNP:143251194
complement(2410)-t, gdbSNP:141789763
complement(2424)-t, cdbSNP:201148050
2433+a, cdbSNP:113706342
2472+c, tdbSNP:5743621
complement(2474)-t, cdbSNP:141132868
complement(2479)-c, adbSNP:145159325
complement(2485)-g, adbSNP:145802478
complement(2492)-g, adbSNP:41305843
complement(2503)-g, adbSNP:200811735
complement(2543)-g, cdbSNP:377263744
complement(2580)-t, cdbSNP:200356797
complement(2606)-t, cdbSNP:371529271
complement(2613)-g, adbSNP:151285692
complement(2617)-t, cdbSNP:144733677
complement(2638)-c, adbSNP:201203468
complement(2641)-t, cdbSNP:367864546
complement(2672)-t, cdbSNP:375393776
2743+g, tdbSNP:56217454
complement(2770)-g, adbSNP:147339251
2799+a, gdbSNP:5743622
2851+a, gdbSNP:4624663
Gene SymbolTLR1
Gene SynonymCD281; rsc786; TIL; TIL. LPRS5
Chromosome4
Locus Map4p14
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003263 Homo sapiens toll-like receptor 1 (TLR1), mRNA. In-stock $99.00 5-7
NM_003263 Homo sapiens toll-like receptor 1 (TLR1), mRNA. In-stock $99.00 5-7
NM_003263 Homo sapiens toll-like receptor 1 (TLR1), mRNA. In-stock $99.00 5-7
NM_003263 Homo sapiens toll-like receptor 1 (TLR1), mRNA. In-stock $99.00 5-7
NM_003263 Homo sapiens toll-like receptor 1 (TLR1), mRNA. In-stock $99.00 5-7
NM_003263 Homo sapiens toll-like receptor 1 (TLR1), mRNA. In-stock $99.00 5-7
Title A meta-analysis of two genome-wide association studies to identify novel loci for maximum number of alcoholic drinks .
Author Kapoor M, Wang JC, Wetherill L, Le N, Bertelsen S, Hinrichs AL, Budde J, Agrawal A, Bucholz K, Dick D, Harari O, Hesselbrock V, Kramer J, Nurnberger JI Jr, Rice J, Saccone N, Schuckit M, Tischfield J, Porjesz B, Edenberg HJ, Bierut L, Foroud T and Goate A.
Journal Hum. Genet. 132 (10), 1141-1151 (2013)
Title Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization .
Author Bonnelykke K, Matheson MC, Pers TH, Granell R, Strachan DP, Alves AC, Linneberg A, Curtin JA, Warrington NM, Standl M, Kerkhof M, Jonsdottir I, Bukvic BK, Kaakinen M, Sleimann P, Thorleifsson G, Thorsteinsdottir U, Schramm K, Baltic S, Kreiner-Moller E, Simpson A, St Pourcain B, Coin L, Hui J, Walters EH, Tiesler CM, Duffy DL, Jones G, Ring SM, McArdle WL, Price L, Robertson CF, Pekkanen J, Tang CS, Thiering E, Montgomery GW, Hartikainen AL, Dharmage SC, Husemoen LL, Herder C, Kemp JP, Elliot P, James A, Waldenberger M, Abramson MJ, Fairfax BP, Knight JC, Gupta R, Thompson PJ, Holt P, Sly P, Hirschhorn JN, Blekic M, Weidinger S, Hakonarsson H, Stefansson K, Heinrich J, Postma DS, Custovic A, Pennell CE, Jarvelin MR, Koppelman GH, Timpson N, Ferreira MA, Bisgaard H and Henderson AJ.
Journal Nat. Genet. 45 (8), 902-906 (2013)
Title A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci .
Author Hinds DA, McMahon G, Kiefer AK, Do CB, Eriksson N, Evans DM, St Pourcain B, Ring SM, Mountain JL, Francke U, Davey-Smith G, Timpson
Journal Nat. Genet. 45 (8), 907-911 (2013)
Title Identification of genetic loci associated with Helicobacter pylori serologic status .
Author Mayerle J, den Hoed CM, Schurmann C, Stolk L, Homuth G, Peters MJ, Capelle LG, Zimmermann K, Rivadeneira F, Gruska S, Volzke H, de Vries AC, Volker U, Teumer A, van Meurs JB, Steinmetz I, Nauck M, Ernst F, Weiss FU, Hofman A, Zenker M, Kroemer HK, Prokisch H, Uitterlinden AG, Lerch MM and Kuipers EJ.
Journal JAMA 309 (18), 1912-1920 (2013)
Title Divergent roles of amino acid residues inside and outside the BB loop affect human Toll-like receptor (TLR)2/2, TLR2/1 and TLR2/6 responsiveness .
Author Qiu Y, Ding Y, Zou L, Tan Z, Liu T, Fu X and Xu W.
Journal PLoS ONE 8 (4), E61508 (2013)
Title Structural basis for signal transduction by the Toll/interleukin-1 receptor domains .
Author Xu Y, Tao X, Shen B, Horng T, Medzhitov R, Manley JL and Tong L.
Journal Nature 408 (6808), 111-115 (2000)
Title Differential expression and regulation of toll-like receptors (TLR) in human leukocytes: selective expression of TLR3 in dendritic cells .
Author Muzio M, Bosisio D, Polentarutti N, D'amico G, Stoppacciaro A, Mancinelli R, van't Veer C, Penton-Rol G, Ruco LP, Allavena P and Mantovani A.
Journal J. Immunol. 164 (11), 5998-6004 (2000)
Title Host defense mechanisms triggered by microbial lipoproteins through toll-like receptors .
Author Brightbill HD, Libraty DH, Krutzik SR, Yang RB, Belisle JT, Bleharski JR, Maitland M, Norgard MV, Plevy SE, Smale ST, Brennan PJ, Bloom BR, Godowski PJ and Modlin RL.
Journal Science 285 (5428), 732-736 (1999)
Title A family of human receptors structurally related to Drosophila Toll .
Author Rock FL, Hardiman G, Timans JC, Kastelein RA and Bazan JF.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (2), 588-593 (1998)
Title Chromosomal localization of TIL, a gene encoding a protein related to the Drosophila transmembrane receptor Toll, to human chromosome 4p14 .
Author Taguchi T, Mitcham JL, Dower SK, Sims JE and Testa JR.
Journal Genomics 32 (3), 486-488 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.