• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta (YWHAH), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003405 Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta (YWHAH), mRNA. GenEZ ORF Cloning In-stock $308.00 $259.00 10

*Business Day

Related Services

RefSeq Version NM_003405.3, 61744461
Length 1807 bp
Structure linear
Update Date 26-JAN-2014
Organism Homo sapiens (human)
Definition Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta (YWHAH), mRNA.
Product 14-3-3 protein eta
Comment

Summary: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. [provided by RefSeq, Jun 2009].

RefSeq NP_003396.1
CDS 242..982
Misc Feature(1)209..211
Misc Feature(2)245..247
Misc Feature(3)245..247
Misc Feature(4)245..247
Misc Feature(5)248..964
Misc Feature(6)order(269..271,278..283,287..292,296..298,305..307,
Misc Feature(7)314..316
Misc Feature(8)order(389..391,410..412,635..640,770..775,782..784,
Misc Feature(9)410..412
Misc Feature(10)416..418
Misc Feature(11)635..637
Exon (1)1..328
Gene:YWHAH
Gene Synonym:YWHA1
Exon (2)329..1793
Gene:YWHAH
Gene Synonym:YWHA1
Translation MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESK VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFS VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE EAGEGN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
88..94+dbSNP:
88..94+, gcctgcadbSNP:71697452
106..112+, gcagcctdbSNP:80248435
149+c, tdbSNP:184614680
181+c, tdbSNP:11539380
220+g, tdbSNP:11539379
357+dbSNP:
357+a, gdbSNP:148198776
367+a, cdbSNP:376719456
418+c, gdbSNP:61752252
432+a, gdbSNP:371520759
447+a, gdbSNP:200741786
484+a, gdbSNP:201984741
571+g, tdbSNP:11539378
657+c, gdbSNP:150273100
668+, adbSNP:145603750
670+a, gdbSNP:78051162
745+a, gdbSNP:8192635
752+a, gdbSNP:367752222
865+a, gdbSNP:113715410
885+c, tdbSNP:75617813
901+a, gdbSNP:35621275
914+c, tdbSNP:369393668
942+c, tdbSNP:201532069
946+c, tdbSNP:377641891
964+a, gdbSNP:139643031
985+a, gdbSNP:78386008
994+a, gdbSNP:1049583
999+c, gdbSNP:80295425
1001+a, gdbSNP:2858755
1006+g, tdbSNP:373594195
1007+c, tdbSNP:376992185
1012+c, tdbSNP:370005433
1026+a, tdbSNP:372639562
1350+g, tdbSNP:186550345
1380+c, tdbSNP:192602237
1492+c, tdbSNP:370416947
1513+c, tdbSNP:185384904
1541+a, gdbSNP:148616662
1585+c, tdbSNP:115884522
1595..1596+, tdbSNP:34145379
1601..1602+, tdbSNP:71697808
1608..1609+, tdbSNP:398036900
1608+g, tdbSNP:77289669
1610+g, tdbSNP:62240587
1611+g, tdbSNP:1049816
1680+a, cdbSNP:142094943
1696..1697+, cdbSNP:34122600
1738+c, tdbSNP:1049865
1763+c, tdbSNP:188688583
Gene SymbolYWHAH
Gene SynonymYWHA1
Chromosome22
Locus Map22q12.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003405 Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta (YWHAH), mRNA. In-stock $308.00 $259.00 10
Title Roles of 14-3-3eta in mitotic progression and its potential use as a therapeutic target for cancers .
Author Lee CG, Park GY, Han YK, Lee JH, Chun SH, Park HY, Lim KH, Kim EG, Choi YJ, Yang K and Lee CW.
Journal Oncogene 32 (12), 1560-1569 (2013)
Title A polymorphism in the YWHAH gene encoding 14-3-3 eta that is not associated with sporadic Creutzfeldt-Jakob disease (CJD) .
Author Yun J, Jeong BH, Kim HJ, Park YJ, Lee YJ, Choi EK, Carp RI and Kim YS.
Journal Mol. Biol. Rep. 39 (4), 3619-3625 (2012)
Title Dermal fibroblasts influence the expression profile of 14-3-3 proteins in human keratinocytes .
Author Carr M, Chavez-Munoz C, Lai A and Ghahary A.
Journal Mol. Cell. Biochem. 353 (1-2), 205-214 (2011)
Title Cytoplasmic expression of p33ING1b is correlated with tumorigenesis and progression of head and neck squamous cell carcinoma .
Author Li XH, Noguchi A, Nishida T, Takahashi H, Zheng Y, Yang XH, Masuda S, Kikuchi K and Takano Y.
Journal Histol. Histopathol. 26 (5), 597-607 (2011)
Title The expression of seven 14-3-3 isoforms in human meningioma .
Author Liu Y, Tian RF, Li YM, Liu WP, Cao L, Yang XL, Cao WD and Zhang X.
Journal Brain Res. 1336, 98-102 (2010)
Title Identification of the site of interaction of the 14-3-3 protein with phosphorylated tryptophan hydroxylase .
Author Ichimura T, Uchiyama J, Kunihiro O, Ito M, Horigome T, Omata S, Shinkai F, Kaji H and Isobe T.
Journal J. Biol. Chem. 270 (48), 28515-28518 (1995)
Title Isoforms of 14-3-3 protein can form homo- and heterodimers in vivo and in vitro: implications for function as adapter proteins .
Author Jones DH, Ley S and Aitken A.
Journal FEBS Lett. 368 (1), 55-58 (1995)
Title cDNA clones contain autonomous replication activity .
Author Wu C, Friedlander P, Lamoureux C, Zannis-Hadjopoulos M and Price GB.
Journal Biochim. Biophys. Acta 1174 (3), 241-257 (1993)
Title cDNA cloning and chromosome assignment of the gene for human brain 14-3-3 protein eta chain .
Author Ichimura-Ohshima Y, Morii K, Ichimura T, Araki K, Takahashi Y, Isobe T, Minoshima S, Fukuyama R, Shimizu N and Kuwano R.
Journal J. Neurosci. Res. 31 (4), 600-605 (1992)
Title Molecular cloning of cDNA coding for brain-specific 14-3-3 protein, a protein kinase-dependent activator of tyrosine and tryptophan hydroxylases .
Author Ichimura T, Isobe T, Okuyama T, Takahashi N, Araki K, Kuwano R and Takahashi Y.
Journal Proc. Natl. Acad. Sci. U.S.A. 85 (19), 7084-7088 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.