• THAT   AND
  • THAT   AND


Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_003405 Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), mRNA. Full Lenth $524.03
ORF Sequence $214.89


RefSeq Version NM_003405.3, 61744461
Length 1807 bp
Structure linear
Update Date 09-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), mRNA.
Product 14-3-3 protein eta
Comment

Summary: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. [provided by RefSeq].

RefSeq NP_003396.1
CDS 242..982
Exon (1)1..328
Exon (2)1..328
Exon (3)329..1793
Translation MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESK VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFS VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE EAGEGN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
88..94+, gcctgcadbSNP:71697452
106..112+, gcagcctdbSNP:71184535
106+, gcagcctdbSNP:80248435
181+c, tdbSNP:11539380
220+g, tdbSNP:11539379
418+c, gdbSNP:61752252
571+g, tdbSNP:11539378
670+a, gdbSNP:78051162
745+a, gdbSNP:8192635
865+a, gdbSNP:113715410
885+c, tdbSNP:75617813
901+a, gdbSNP:35621275
985+a, gdbSNP:78386008
994+a, gdbSNP:1049583
999+c, gdbSNP:80295425
1001+a, gdbSNP:2858755
1585+c, tdbSNP:115884522
1594..1595+, tdbSNP:34145379
1595..1596+, tdbSNP:66459571
1600..1601+, tdbSNP:71721992
1601..1602+, ttdbSNP:71697808
1608..1609+, tdbSNP:71184539
1608+g, tdbSNP:77289669
1608+, tdbSNP:71790951
1609..1610+, tdbSNP:71930073
1610+g, tdbSNP:62240587
1611+g, tdbSNP:1049816
1696..1697+, cdbSNP:34122600
1738+c, tdbSNP:1049865
Gene SymbolYWHAH
Gene SynonymYWHA1
Chromosome22
Locus Map22q12.3
All Transcripts NM_003405
Title The expression of seven 14-3-3 isoforms in human meningioma .
Author Liu,Y., Tian,R.F., Li,Y.M., Liu,W.P., Cao,L., Yang,X.L., Cao,W.D. and Zhang,X.
Journal Brain Res. 1336, 98-102 (2010)
Title Family-based association of YWHAH in psychotic bipolar disorder .
Author Grover,D., Verma,R., Goes,F.S., Mahon,P.L., Gershon,E.S., McMahon,F.J., Potash,J.B., Gershon,E.S., McMahon,F.J. and Potash,J.B.
Journal Am. J. Med. Genet. B Neuropsychiatr. Genet. 150B (7), 977-983 (2009)
Title Identification of five novel 14-3-3 isoforms interacting with the GPIb-IX complex in platelets .
Author Mangin,P.H., Receveur,N., Wurtz,V., David,T., Gachet,C. and Lanza,F.
Journal J. Thromb. Haemost. 7 (9), 1550-1555 (2009)
Title Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis .
Author Martins-de-Souza,D., Gattaz,W.F., Schmitt,A., Rewerts,C., Marangoni,S., Novello,J.C., Maccarrone,G., Turck,C.W. and Dias-Neto,E.
Journal J Neural Transm 116 (3), 275-289 (2009)
Title Phosphorylation-dependent binding of 14-3-3 terminates signalling by the Gab2 docking protein .
Author Brummer,T., Larance,M., Herrera Abreu,M.T., Lyons,R.J., Timpson,P., Emmerich,C.H., Fleuren,E.D., Lehrbach,G.M., Schramek,D., Guilhaus,M., James,D.E. and Daly,R.J.
Journal EMBO J. 27 (17), 2305-2316 (2008)
Title Identification of the site of interaction of the 14-3-3 protein with phosphorylated tryptophan hydroxylase .
Author Ichimura,T., Uchiyama,J., Kunihiro,O., Ito,M., Horigome,T., Omata,S., Shinkai,F., Kaji,H. and Isobe,T.
Journal J. Biol. Chem. 270 (48), 28515-28518 (1995)
Title Isoforms of 14-3-3 protein can form homo- and heterodimers in vivo and in vitro: implications for function as adapter proteins .
Author Jones,D.H., Ley,S. and Aitken,A.
Journal FEBS Lett. 368 (1), 55-58 (1995)
Title cDNA clones contain autonomous replication activity .
Author Wu,C., Friedlander,P., Lamoureux,C., Zannis-Hadjopoulos,M. and Price,G.B.
Journal Biochim. Biophys. Acta 1174 (3), 241-257 (1993)
Title cDNA cloning and chromosome assignment of the gene for human brain 14-3-3 protein eta chain .
Author Ichimura-Ohshima,Y., Morii,K., Ichimura,T., Araki,K., Takahashi,Y., Isobe,T., Minoshima,S., Fukuyama,R., Shimizu,N. and Kuwano,R.
Journal J. Neurosci. Res. 31 (4), 600-605 (1992)
Title Molecular cloning of cDNA coding for brain-specific 14-3-3 protein, a protein kinase-dependent activator of tyrosine and tryptophan hydroxylases .
Author Ichimura,T., Isobe,T., Okuyama,T., Takahashi,N., Araki,K., Kuwano,R. and Takahashi,Y.
Journal Proc. Natl. Acad. Sci. U.S.A. 85 (19), 7084-7088 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878