• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), mRNA.


RefSeq Accession Definition Services Price Order
NM_003405 Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), mRNA. ORF Sequence $214.89
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_003405.3, 61744461
Length 1807 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), mRNA.
Product 14-3-3 protein eta
Comment

Summary: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. [provided by RefSeq, Jun 2009].

RefSeq NP_003396.1
CDS 242..982
Misc Feature(1)209..211
Misc Feature(2)245..247
Misc Feature(3)245..247
Misc Feature(4)245..247
Misc Feature(5)248..964
Misc Feature(6)order(269..271,278..283,287..292,296..298,305..307,
Misc Feature(7)314..316
Misc Feature(8)order(389..391,410..412,635..640,770..775,782..784,
Misc Feature(9)410..412
Misc Feature(10)416..418
Misc Feature(11)635..637
Exon (1)1..328
Gene:YWHAH
Gene Synonym:YWHA1
Exon (2)329..1793
Gene:YWHAH
Gene Synonym:YWHA1
Translation MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESK VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFS VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE EAGEGN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
88..94+dbSNP:
88..94+, gcctgcadbSNP:71697452
92..98+, gcagcctdbSNP:71184535
92+, gcagcctdbSNP:80248435
149+c, tdbSNP:184614680
181+c, tdbSNP:11539380
220+g, tdbSNP:11539379
357+dbSNP:
357+a, gdbSNP:148198776
418+c, gdbSNP:61752252
447+a, gdbSNP:200741786
484+a, gdbSNP:201984741
571+g, tdbSNP:11539378
657+c, gdbSNP:150273100
668+, adbSNP:145603750
670+a, gdbSNP:78051162
731+a, cdbSNP:138989916
745+a, gdbSNP:8192635
814+a, gdbSNP:142193334
865+a, gdbSNP:113715410
885+c, tdbSNP:75617813
901+a, gdbSNP:35621275
942+c, tdbSNP:201532069
964+a, gdbSNP:139643031
985+a, gdbSNP:78386008
994+a, gdbSNP:1049583
999+c, gdbSNP:80295425
1001+a, gdbSNP:2858755
1350+g, tdbSNP:186550345
1380+c, tdbSNP:192602237
1513+c, tdbSNP:185384904
1541+a, gdbSNP:148616662
1585+c, tdbSNP:115884522
1594..1595+, tdbSNP:34145379
1595..1596+, tdbSNP:66459571
1595+, tdbSNP:71790951
1601..1602+, t, ttdbSNP:71697808
1608+g, tdbSNP:77289669
1610+g, tdbSNP:62240587
1611+g, tdbSNP:1049816
1680+a, cdbSNP:142094943
1696..1697+, cdbSNP:34122600
1738+c, tdbSNP:1049865
1763+c, tdbSNP:188688583
Gene SymbolYWHAH
Gene SynonymYWHA1
Chromosome22
Locus Map22q12.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_003405 Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), mRNA. Full Length $524.03
ORF Sequence $214.89
Title A polymorphism in the YWHAH gene encoding 14-3-3 eta that is not associated with sporadic Creutzfeldt-Jakob disease (CJD) .
Author Yun,J., Jeong,B.H., Kim,H.J., Park,Y.J., Lee,Y.J., Choi,E.K., Carp,R.I. and Kim,Y.S.
Journal Mol. Biol. Rep. 39 (4), 3619-3625 (2012)
Title Dermal fibroblasts influence the expression profile of 14-3-3 proteins in human keratinocytes .
Author Carr,M., Chavez-Munoz,C., Lai,A. and Ghahary,A.
Journal Mol. Cell. Biochem. 353 (1-2), 205-214 (2011)
Title Cytoplasmic expression of p33ING1b is correlated with tumorigenesis and progression of head and neck squamous cell carcinoma .
Author Li,X.H., Noguchi,A., Nishida,T., Takahashi,H., Zheng,Y., Yang,X.H., Masuda,S., Kikuchi,K. and Takano,Y.
Journal Histol. Histopathol. 26 (5), 597-607 (2011)
Title The expression of seven 14-3-3 isoforms in human meningioma .
Author Liu,Y., Tian,R.F., Li,Y.M., Liu,W.P., Cao,L., Yang,X.L., Cao,W.D. and Zhang,X.
Journal Brain Res. 1336, 98-102 (2010)
Title Identification of five novel 14-3-3 isoforms interacting with the GPIb-IX complex in platelets .
Author Mangin,P.H., Receveur,N., Wurtz,V., David,T., Gachet,C. and Lanza,F.
Journal J. Thromb. Haemost. 7 (9), 1550-1555 (2009)
Title Identification of the site of interaction of the 14-3-3 protein with phosphorylated tryptophan hydroxylase .
Author Ichimura,T., Uchiyama,J., Kunihiro,O., Ito,M., Horigome,T., Omata,S., Shinkai,F., Kaji,H. and Isobe,T.
Journal J. Biol. Chem. 270 (48), 28515-28518 (1995)
Title Isoforms of 14-3-3 protein can form homo- and heterodimers in vivo and in vitro: implications for function as adapter proteins .
Author Jones,D.H., Ley,S. and Aitken,A.
Journal FEBS Lett. 368 (1), 55-58 (1995)
Title cDNA clones contain autonomous replication activity .
Author Wu,C., Friedlander,P., Lamoureux,C., Zannis-Hadjopoulos,M. and Price,G.B.
Journal Biochim. Biophys. Acta 1174 (3), 241-257 (1993)
Title cDNA cloning and chromosome assignment of the gene for human brain 14-3-3 protein eta chain .
Author Ichimura-Ohshima,Y., Morii,K., Ichimura,T., Araki,K., Takahashi,Y., Isobe,T., Minoshima,S., Fukuyama,R., Shimizu,N. and Kuwano,R.
Journal J. Neurosci. Res. 31 (4), 600-605 (1992)
Title Molecular cloning of cDNA coding for brain-specific 14-3-3 protein, a protein kinase-dependent activator of tyrosine and tryptophan hydroxylases .
Author Ichimura,T., Isobe,T., Okuyama,T., Takahashi,N., Araki,K., Kuwano,R. and Takahashi,Y.
Journal Proc. Natl. Acad. Sci. U.S.A. 85 (19), 7084-7088 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878