• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 3, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003639 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 3, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_003639.3, 142381344
Length 2120 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 3, mRNA.
Product NF-kappa-B essential modulator isoform a
Comment

Summary: This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. Multiple transcript variants encoding different isoforms have been found for this gene. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome. [provided by RefSeq, Aug 2011].


Transcript Variant: This variant (3) represents use of an alternate promoter and 5' UTR, compared to variant 1. Variants 1 and 3 both encode the same isoform (a).


Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly.

RefSeq NP_003630.1
CDS 259..1518
Misc Feature(1)241..243
Misc Feature(2)349..351
Misc Feature(3)349..351
Misc Feature(4)349..351
Misc Feature(5)385..387
Misc Feature(6)385..387
Misc Feature(7)388..591
Misc Feature(8)388..591
Misc Feature(9)460..462
Misc Feature(10)511..513
Misc Feature(11)706..1029
Misc Feature(12)982..1308
Misc Feature(13)994..1353
Misc Feature(14)1009..1515
Misc Feature(15)<1099..>1194
Misc Feature(16)order(1144..1146,1156..1161,1165..1170,1177..1185,
Misc Feature(17)1222..1287
Misc Feature(18)1384..1386
Misc Feature(19)1384..1386
Misc Feature(20)1402..1515
Misc Feature(21)1453..1455
Exon (1)1..243
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (2)244..445
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (3)446..657
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (4)658..776
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (5)777..929
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (6)930..1026
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (7)1027..1170
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (8)1171..1313
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (9)1314..1375
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Exon (10)1376..2103
Gene:IKBKG
Gene Synonym:AMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
Translation MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
29+dbSNP:
29+c, tdbSNP:56191948
46+a, cdbSNP:5986992
94+c, gdbSNP:56262786
116+g, tdbSNP:73641104
197+a, gdbSNP:183785399
265+a, cdbSNP:57174646
396+c, tdbSNP:149511938
397+a, gdbSNP:143999678
427+a, gdbSNP:148695964
442+c, tdbSNP:137853323
595+dbSNP:
595+a, gdbSNP:179363896
625+c, tdbSNP:179363895
716+dbSNP:
716+g, tdbSNP:137853328
775+c, gdbSNP:179363866
782+dbSNP:
782+c, gdbSNP:179363868
938+dbSNP:
938+c, tdbSNP:179363869
1121+dbSNP:
1121+c, gdbSNP:137853330
1189+dbSNP:
1189+a, gdbSNP:179363867
1202+a, cdbSNP:137853331
1214+a, gdbSNP:137853332
1225+c, gdbSNP:179363865
1429+dbSNP:
1429+g, tdbSNP:137853324
1465+c, tdbSNP:137853329
1475+a, tdbSNP:137853327
1477+a, gdbSNP:137853322
1507+c, tdbSNP:137853325
1508+a, g, tdbSNP:137853326
1517+a, gdbSNP:137853321
Gene SymbolIKBKG
Gene SynonymAMCBX1; FIP-3; FIP3; Fip3p; IKK-gamma; IP; IP1; IP2; IPD2; NEMO; ZC2HC9
ChromosomeX
Locus MapXq28
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001099856 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 2, mRNA. On-demand $699.00 18
NM_001099857 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1, mRNA. On-demand $699.00 18
NM_001145255 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 4, mRNA. On-demand $549.00 14
NM_003639 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 3, mRNA. On-demand $699.00 18
Title FIP3-endosome-dependent formation of the secondary ingression mediates ESCRT-III recruitment during cytokinesis .
Author Schiel,J.A., Simon,G.C., Zaharris,C., Weisz,J., Castle,D., Wu,C.C. and Prekeris,R.
Journal Nat. Cell Biol. 14 (10), 1068-1078 (2012)
Title Linear ubiquitination of NEMO negatively regulates the interferon antiviral response through disruption of the MAVS-TRAF3 complex .
Author Belgnaoui,S.M., Paz,S., Samuel,S., Goulet,M.L., Sun,Q., Kikkert,M., Iwai,K., Dikic,I., Hiscott,J. and Lin,R.
Journal Cell Host Microbe 12 (2), 211-222 (2012)
Title Novel Phosphorylations of IKKgamma/NEMO .
Author Lee,S.H., Toth,Z., Wong,L.Y., Brulois,K., Nguyen,J., Lee,J.Y., Zandi,E. and Jung,J.U.
Journal MBio 3 (6), E00411-E00412 (2012)
Title p47 negatively regulates IKK activation by inducing the lysosomal degradation of polyubiquitinated NEMO .
Author Shibata,Y., Oyama,M., Kozuka-Hata,H., Han,X., Tanaka,Y., Gohda,J. and Inoue,J.
Journal Nat Commun 3, 1061 (2012)
Title NEMO inhibits programmed necrosis in an NFkappaB-independent manner by restraining RIP1 .
Author O'Donnell,M.A., Hase,H., Legarda,D. and Ting,A.T.
Journal PLoS ONE 7 (7), E41238 (2012)
Title Isolation of full-length cDNA and chromosomal localization of human NF-kappaB modulator NEMO to Xq28 .
Author Jin,D.Y. and Jeang,K.T.
Journal J. Biomed. Sci. 6 (2), 115-120 (1999)
Title Identification of a cell protein (FIP-3) as a modulator of NF-kappaB activity and as a target of an adenovirus inhibitor of tumor necrosis factor alpha-induced apoptosis .
Author Li,Y., Kang,J., Friedman,J., Tarassishin,L., Ye,J., Kovalenko,A., Wallach,D. and Horwitz,M.S.
Journal Proc. Natl. Acad. Sci. U.S.A. 96 (3), 1042-1047 (1999)
Title IkappaB kinase (IKK)-associated protein 1, a common component of the heterogeneous IKK complex .
Author Mercurio,F., Murray,B.W., Shevchenko,A., Bennett,B.L., Young,D.B., Li,J.W., Pascual,G., Motiwala,A., Zhu,H., Mann,M. and Manning,A.M.
Journal Mol. Cell. Biol. 19 (2), 1526-1538 (1999)
Title IKK-gamma is an essential regulatory subunit of the IkappaB kinase complex .
Author Rothwarf,D.M., Zandi,E., Natoli,G. and Karin,M.
Journal Nature 395 (6699), 297-300 (1998)
Title Tumor necrosis factor receptor-associated factors (TRAFs)--a family of adapter proteins that regulates life and death .
Author Arch,R.H., Gedrich,R.W. and Thompson,C.B.
Journal Genes Dev. 12 (18), 2821-2830 (1998)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.