• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein (IKBKAP), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003640 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein (IKBKAP), mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_003640.3, 189163479
Length 6129 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein (IKBKAP), mRNA.
Product elongator complex protein 1
Comment

Summary: The protein encoded by this gene is a scaffold protein and a regulator for 3 different kinases involved in proinflammatory signaling. This encoded protein can bind NF-kappa-B-inducing kinase (NIK) and IKKs through separate domains and assemble them into an active kinase complex. Mutations in this gene have been associated with familial dysautonomia. [provided by RefSeq, Jul 2008].

RefSeq NP_003631.2
CDS 521..4519
Misc Feature(1)488..490
Misc Feature(2)488..490
Misc Feature(3)521..3382
Misc Feature(4)521..3382
Misc Feature(5)3119..3121
Misc Feature(6)4031..4033
Misc Feature(7)4040..4042
Exon (1)1..465
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (2)466..670
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (3)671..823
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (4)824..905
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (5)906..986
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (6)987..1072
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (7)1073..1169
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (8)1170..1260
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (9)1261..1384
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (10)1385..1478
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (11)1479..1709
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (12)1710..1880
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (13)1881..1980
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (14)1981..2163
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (15)2164..2270
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (16)2271..2374
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (17)2375..2428
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (18)2429..2534
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (19)2535..2650
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (20)2651..2724
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (21)2725..2803
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (22)2804..2883
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (23)2884..3021
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (24)3022..3107
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (25)3108..3256
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (26)3257..3380
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (27)3381..3478
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (28)3479..3680
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (29)3681..3742
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (30)3743..3805
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (31)3806..3866
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (32)3867..3980
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (33)3981..4092
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (34)4093..4220
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (35)4221..4375
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (36)4376..4451
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Exon (37)4452..6114
Gene:IKBKAP
Gene Synonym:DYS; ELP1; FD; IKAP; IKI3; TOT1
Translation MRNLKLFRTLEFRDIQGPGNPQCFSLRTEQGTVLIGSEHGLIEVDPVSREVKNEVSLVAE GFLPEDGSGRIVGVQDLLDQESVCVATASGDVILCSLSTQQLECVGSVASGISVMSWSPD QELVLLATGQQTLIMMTKDFEPILEQQIHQDDFGESKFITVGWGRKETQFHGSEGRQAAF QMQMHESALPWDDHRPQVTWRGDGQFFAVSVVCPETGARKVRVWNREFALQSTSEPVAGL GPALAWKPSGSLIASTQDKPNQQDIVFFEKNGLLHGHFTLPFLKDEVKVNDLLWNADSSV LAVWLEDLQREESSIPKTCVQLWTVGNYHWYLKQSLSFSTCGKSKIVSLMWDPVTPYRLH VLCQGWHYLAYDWHWTTDRSVGDNSSDLSNVAVIDGNRVLVTVFRQTVVPPPMCTYQLLF PHPVNQVTFLAHPQKSNDLAVLDASNQISVYKCGDCPSADPTVKLGAVGGSGFKVCLRTP HLEKRYKIQFENNEDQDVNPLKLGLLTWIEEDVFLAVSHSEFSPRSVIHHLTAASSEMDE EHGQLNVSSSAAVDGVIISLCCNSKTKSVVLQLADGQIFKYLWESPSLAIKPWKNSGGFP VRFPYPCTQTELAMIGEEECVLGLTDRCRFFINDIEVASNITSFAVYDEFLLLTTHSHTC QCFCLRDASFKTLQAGLSSNHVSHGEVLRKVERGSRIVTVVPQDTKLVLQMPRGNLEVVH HRALVLAQIRKWLDKLMFKEAFECMRKLRINLNLIYDHNPKVFLGNVETFIKQIDSVNHI NLFFTELKEEDVTKTMYPAPVTSSVYLSRDPDGNKIDLVCDAMRAVMESINPHKYCLSIL TSHVKKTTPELEIVLQKVHELQGNAPSDPDAVSAEEALKYLLHLVDVNELYDHSLGTYDF DLVLMVAEKSQKDPKEYLPFLNTLKKMETNYQRFTIDKYLKRYEKAIGHLSKCGPEYFPE CLNLIKDKNLYNEALKLYSPSSQQYQDISIAYGEHLMQEHMYEPAGLMFARCGAHEKALS AFLTCGNWKQALCVAAQLNFTKDQLVGLGRTLAGKLVEQRKHIDAAMVLEECAQDYEEAV LLLLEGAAWEEALRLVYKYNRLDIIETNVKPSILEAQKNYMAFLDSQTATFSRHKKRLLV VRELKEQAQQAGLDDEVPHGQESDLFSETSSVVSGSEMSGKYSHSNSRISARSSKNRRKA ERKKHSLKEGSPLEDLALLEALSEVVQNTENLKDEVYHILKVLFLFEFDEQGRELQKAFE DTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKI NRRTQWKLSLLD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(46)-dbSNP:
complement(46)-, gdbSNP:11318862
complement(220)-g, cdbSNP:2275641
complement(344)-g, adbSNP:138630440
complement(366)-t, cdbSNP:117100816
complement(395)-c, adbSNP:2275640
complement(417)-g, adbSNP:114048427
complement(450)-g, cdbSNP:2275639
complement(499)-c, adbSNP:150608921
complement(504)-t, cdbSNP:199738099
complement(508)-t, cdbSNP:142031825
complement(542)-g, adbSNP:150202264
complement(570)-t, cdbSNP:184017312
complement(579)-t, cdbSNP:201242143
complement(620)-g, adbSNP:140944971
complement(659)-c, adbSNP:151209640
complement(674)-dbSNP:
complement(674)-t, cdbSNP:143494120
complement(709)-t, cdbSNP:2230786
complement(723)-c, adbSNP:143723093
complement(728)-g, adbSNP:3737311
complement(729)-t, cdbSNP:111936933
complement(757)-g, adbSNP:200920506
complement(790)-t, adbSNP:200640674
complement(806)-t, cdbSNP:35942802
complement(842)-dbSNP:
complement(842)-t, cdbSNP:192047457
complement(868)-t, cdbSNP:2230787
complement(930)-dbSNP:
complement(930)-t, gdbSNP:201460139
complement(961)-g, adbSNP:2230788
complement(1002)-dbSNP:
complement(1002)-g, adbSNP:149617554
complement(1031)-g, cdbSNP:202179488
complement(1065)-t, adbSNP:10521092
complement(1108)-dbSNP:
complement(1108)-t, cdbSNP:146875913
complement(1137)-c, adbSNP:184739734
complement(1250)-dbSNP:
complement(1250)-g, cdbSNP:200836328
complement(1271)-dbSNP:
complement(1271)-t, cdbSNP:17853166
complement(1336)-t, gdbSNP:201336920
complement(1339)-g, adbSNP:12340246
complement(1378)-t, cdbSNP:147517999
complement(1382)-t, cdbSNP:202184408
complement(1429)-dbSNP:
complement(1429)-g, cdbSNP:142420285
complement(1443)-g, adbSNP:78135392
complement(1454)-g, adbSNP:1140064
complement(1468)-t, cdbSNP:148917889
complement(1478)-t, cdbSNP:145866678
complement(1537)-dbSNP:
complement(1537)-t, gdbSNP:56053149
complement(1539)-g, adbSNP:200449531
complement(1580)-c, adbSNP:187183483
complement(1593)-t, cdbSNP:139091484
complement(1595)-t, cdbSNP:2230789
complement(1636)-g, adbSNP:144878787
complement(1638)-c, adbSNP:141141120
complement(1643)-g, adbSNP:201976177
complement(1649)-t, cdbSNP:34487171
complement(1663)-t, cdbSNP:35936107
complement(1733)-dbSNP:
complement(1733)-g, adbSNP:139703788
complement(1744)-t, cdbSNP:151157900
complement(1750)-t, cdbSNP:41278359
complement(1829)-t, gdbSNP:148609833
complement(1843)-g, adbSNP:200925118
complement(1863)-g, adbSNP:147575152
complement(1884)-dbSNP:
complement(1884)-t, cdbSNP:149685738
complement(1959..1961)-, gagdbSNP:139472133
complement(1986)-dbSNP:
complement(1986)-t, gdbSNP:140229715
complement(2057)-t, cdbSNP:201706900
complement(2094)-t, cdbSNP:838827
complement(2123)-g, adbSNP:200170465
complement(2146)-g, adbSNP:149396381
complement(2175)-dbSNP:
complement(2175)-g, adbSNP:139891858
complement(2176)-t, cdbSNP:200535861
complement(2195)-t, adbSNP:150638391
complement(2213)-t, cdbSNP:141915722
complement(2213)-, t, adbSNP:143099062
complement(2224)-t, cdbSNP:138192941
complement(2241)-g, adbSNP:35455790
complement(2247)-t, cdbSNP:56229130
complement(2255)-g, adbSNP:199555804
complement(2278)-dbSNP:
complement(2278)-c, adbSNP:35054425
complement(2320)-g, adbSNP:143315808
complement(2324)-g, adbSNP:200397694
complement(2338)-t, cdbSNP:138099341
complement(2340)-t, cdbSNP:146077661
complement(2350)-g, adbSNP:113048987
complement(2357)-t, cdbSNP:141324198
complement(2387)-dbSNP:
complement(2387)-c, adbSNP:150819862
complement(2396)-g, cdbSNP:202085601
complement(2398)-g, adbSNP:141596257
complement(2406)-t, cdbSNP:148378319
complement(2433)-dbSNP:
complement(2433)-g, adbSNP:144370288
complement(2434)-t, cdbSNP:142096497
complement(2441)-t, cdbSNP:142265393
complement(2446)-t, cdbSNP:10979605
complement(2466)-t, cdbSNP:201520655
complement(2485)-t, cdbSNP:2230791
complement(2495)-t, gdbSNP:200117008
complement(2529)-c, adbSNP:139479557
complement(2545)-dbSNP:
complement(2545)-g, adbSNP:200532312
complement(2563)-g, adbSNP:147944437
complement(2585)-g, adbSNP:201390288
complement(2586)-t, cdbSNP:201742754
complement(2607)-g, c, adbSNP:137853022
complement(2615)-t, cdbSNP:148769518
complement(2617)-g, adbSNP:144352068
complement(2629)-t, cdbSNP:71499676
complement(2679)-dbSNP:
complement(2679)-t, adbSNP:138076464
complement(2690)-g, cdbSNP:150005243
complement(2692)-g, cdbSNP:202166505
complement(2737)-dbSNP:
complement(2737)-t, cdbSNP:139583037
complement(2774)-g, cdbSNP:182287137
complement(2778)-t, gdbSNP:201601641
complement(2804)-dbSNP:
complement(2804)-t, cdbSNP:146338880
complement(2814)-g, c, adbSNP:2230792
complement(2815)-t, adbSNP:137874743
complement(2898)-dbSNP:
complement(2898)-g, adbSNP:201596987
complement(2914)-g, adbSNP:138819925
complement(2937)-t, cdbSNP:191464698
complement(2956)-g, adbSNP:113967847
complement(2966)-c, adbSNP:2230793
complement(2980)-g, adbSNP:181121832
complement(3010)-g, adbSNP:2230794
complement(3018)-t, gdbSNP:201714373
complement(3063)-dbSNP:
complement(3063)-t, gdbSNP:10979599
complement(3065)-g, cdbSNP:34550675
complement(3087)-t, gdbSNP:142186193
complement(3098)-t, cdbSNP:137983175
complement(3099)-t, cdbSNP:199796698
complement(3149)-dbSNP:
complement(3149)-t, cdbSNP:146958186
complement(3151)-g, adbSNP:138023874
complement(3160)-g, adbSNP:180790273
complement(3206)-t, cdbSNP:200590656
complement(3213)-t, cdbSNP:199679232
complement(3261)-dbSNP:
complement(3261)-t, cdbSNP:28939712
complement(3268)-t, cdbSNP:200551647
complement(3323)-t, adbSNP:145484092
complement(3327)-g, adbSNP:199617267
complement(3345)-t, cdbSNP:149845612
complement(3365)-g, adbSNP:201440191
complement(3375)-t, adbSNP:2230798
complement(3428)-dbSNP:
complement(3428)-t, adbSNP:180931232
complement(3430)-t, cdbSNP:146198104
complement(3440)-t, cdbSNP:151120244
complement(3462)-t, cdbSNP:187975522
complement(3487)-dbSNP:
complement(3487)-g, adbSNP:141567919
complement(3497)-t, cdbSNP:201873298
complement(3502)-t, cdbSNP:147870527
complement(3522)-g, adbSNP:144959233
complement(3534)-g, adbSNP:55658431
complement(3557)-g, adbSNP:2230795
complement(3579..3580)-, tdbSNP:151101843
complement(3589)-g, c, adbSNP:1063110
complement(3621)-t, adbSNP:146319455
complement(3671)-t, cdbSNP:148548795
complement(3690)-dbSNP:
complement(3690)-g, adbSNP:147069577
complement(3721)-t, cdbSNP:143091867
complement(3725)-g, adbSNP:112178985
complement(3733)-g, cdbSNP:140024352
complement(3734)-t, adbSNP:3204145
complement(3779)-dbSNP:
complement(3779)-t, cdbSNP:61749203
complement(3800)-t, cdbSNP:146440397
complement(3801)-t, cdbSNP:200941360
complement(3803)-g, cdbSNP:150595103
complement(3829)-dbSNP:
complement(3829)-t, gdbSNP:1140075
complement(3918)-dbSNP:
complement(3918)-t, cdbSNP:143580972
complement(3937)-g, cdbSNP:202080366
complement(3981)-dbSNP:
complement(3981)-t, cdbSNP:202165319
complement(3993)-t, cdbSNP:1538660
complement(3994)-g, adbSNP:146956297
complement(3997)-g, adbSNP:141257064
complement(4012)-g, adbSNP:79596285
complement(4013)-g, adbSNP:144301886
complement(4033)-g, adbSNP:199617076
complement(4041)-c, adbSNP:143008686
complement(4050)-t, cdbSNP:200543069
complement(4051)-c, adbSNP:149585292
complement(4071)-t, cdbSNP:201781695
complement(4111)-dbSNP:
complement(4111)-g, adbSNP:144202915
complement(4113)-t, cdbSNP:200322331
complement(4124)-g, adbSNP:201168521
complement(4155)-t, gdbSNP:200009363
complement(4157)-c, adbSNP:1802207
complement(4249)-dbSNP:
complement(4249)-g, cdbSNP:201673697
complement(4266)-t, gdbSNP:75395135
complement(4270)-t, cdbSNP:149038322
complement(4304)-t, cdbSNP:200634033
complement(4305)-g, adbSNP:199723919
complement(4311)-t, cdbSNP:201888676
complement(4336)-t, cdbSNP:145380688
complement(4339)-g, adbSNP:201242444
complement(4374)-g, adbSNP:199813856
complement(4389)-dbSNP:
complement(4389)-t, cdbSNP:145319352
complement(4396)-c, adbSNP:61749202
complement(4423)-c, adbSNP:200524123
complement(4438)-t, cdbSNP:146862778
complement(4469)-dbSNP:
complement(4469)-t, gdbSNP:199595486
complement(4507)-g, adbSNP:144816863
complement(4543)-g, cdbSNP:201039322
complement(4594)-g, adbSNP:181667931
complement(4606)-g, adbSNP:149407371
complement(4609)-g, adbSNP:149683800
complement(4892)-t, cdbSNP:150965414
complement(4911)-t, cdbSNP:10979577
complement(4954)-t, adbSNP:1802208
complement(5021)-g, adbSNP:56305287
complement(5358)-t, cdbSNP:41313309
complement(5361)-g, adbSNP:115855085
complement(5380)-c, adbSNP:74671462
complement(5421)-g, adbSNP:139728295
complement(5430)-g, adbSNP:146393718
complement(5590)-t, cdbSNP:41305457
complement(5733)-g, adbSNP:143906434
complement(5766)-g, adbSNP:76994656
complement(5778..5779)-gg, acdbSNP:66608307
complement(5778)-g, cdbSNP:13299652
complement(5779)-g, adbSNP:13299651
complement(5792)-t, adbSNP:140005128
complement(5800)-g, adbSNP:189897190
complement(5870)-t, gdbSNP:4978371
complement(5931)-t, adbSNP:117081559
complement(5948)-g, adbSNP:199666995
complement(5996)-g, adbSNP:144244054
complement(6008)-t, cdbSNP:78224677
Gene SymbolIKBKAP
Gene SynonymDYS; ELP1; FD; IKAP; IKI3; TOT1
Chromosome9
Locus Map9q31
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003640 Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein (IKBKAP), mRNA. On-demand $1699.00 25
Title Nutraceutical-mediated restoration of wild-type levels of IKBKAP-encoded IKAP protein in familial dysautonomia-derived cells .
Author Anderson,S.L., Liu,B., Qiu,J., Sturm,A.J., Schwartz,J.A., Peters,A.J., Sullivan,K.A. and Rubin,B.Y.
Journal Mol Nutr Food Res 56 (4), 570-579 (2012)
Title IKAP/Elp1 is required in vivo for neurogenesis and neuronal survival, but not for neural crest migration .
Author Hunnicutt,B.J., Chaverra,M., George,L. and Lefcort,F.
Journal PLoS ONE 7 (2), E32050 (2012)
Title IKAP/Elp1 involvement in cytoskeleton regulation and implication for familial dysautonomia .
Author Cheishvili,D., Maayan,C., Cohen-Kupiec,R., Lefler,S., Weil,M., Ast,G. and Razin,A.
Journal Hum. Mol. Genet. 20 (8), 1585-1594 (2011)
Title Effects of IKAP/hELP1 deficiency on gene expression in differentiating neuroblastoma cells: implications for familial dysautonomia .
Author Cohen-Kupiec,R., Pasmanik-Chor,M., Oron-Karni,V. and Weil,M.
Journal PLoS ONE 6 (4), E19147 (2011)
Title Phosphatidylserine increases IKBKAP levels in familial dysautonomia cells .
Author Keren,H., Donyo,M., Zeevi,D., Maayan,C., Pupko,T. and Ast,G.
Journal PLoS ONE 5 (12), E15884 (2010)
Title Familial dysautonomia is caused by mutations of the IKAP gene .
Author Anderson,S.L., Coli,R., Daly,I.W., Kichula,E.A., Rork,M.J., Volpi,S.A., Ekstein,J. and Rubin,B.Y.
Journal Am. J. Hum. Genet. 68 (3), 753-758 (2001)
Title Tissue-specific expression of a splicing mutation in the IKBKAP gene causes familial dysautonomia .
Author Slaugenhaupt,S.A., Blumenfeld,A., Gill,S.P., Leyne,M., Mull,J., Cuajungco,M.P., Liebert,C.B., Chadwick,B., Idelson,M., Reznik,L., Robbins,C., Makalowska,I., Brownstein,M., Krappmann,D., Scheidereit,C., Maayan,C., Axelrod,F.B. and Gusella,J.F.
Journal Am. J. Hum. Genet. 68 (3), 598-605 (2001)
Title The kinase TAK1 can activate the NIK-I kappaB as well as the MAP kinase cascade in the IL-1 signalling pathway .
Author Ninomiya-Tsuji,J., Kishimoto,K., Hiyama,A., Inoue,J., Cao,Z. and Matsumoto,K.
Journal Nature 398 (6724), 252-256 (1999)
Title IKAP is a scaffold protein of the IkappaB kinase complex .
Author Cohen,L., Henzel,W.J. and Baeuerle,P.A.
Journal Nature 395 (6699), 292-296 (1998)
Title Localization of the gene for familial dysautonomia on chromosome 9 and definition of DNA markers for genetic diagnosis .
Author Blumenfeld,A., Slaugenhaupt,S.A., Axelrod,F.B., Lucente,D.E., Maayan,C., Liebert,C.B., Ozelius,L.J., Trofatter,J.A., Haines,J.L., Breakefield,X.O. et al.
Journal Nat. Genet. 4 (2), 160-164 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.