• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens calcium/calmodulin-dependent protein kinase I (CAMK1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu37531 Homo sapiens calcium/calmodulin-dependent protein kinase I (CAMK1), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu37531C Homo sapiens calcium/calmodulin-dependent protein kinase I (CAMK1), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_003656.4, 325995171
Length 1113 bp
Structure linear
Update Date 12-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens calcium/calmodulin-dependent protein kinase I (CAMK1), mRNA.
Product calcium/calmodulin-dependent protein kinase type 1
Comment

Summary: Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase. [provided by RefSeq, Jul 2008].

RefSeq NP_003647.1
CDS 186..1298
Misc Feature(1)81..83
Misc Feature(2)243..1013
Misc Feature(3)243..1013
Misc Feature(4)261..1010
Misc Feature(5)order(261..275,285..287,324..326,330..332,420..422,
Misc Feature(6)order(261..275,285..287,324..326,330..332,420..422,
Misc Feature(7)order(273..275,489..491,495..497,606..608,612..614,
Misc Feature(8)order(666..689,714..734)
Misc Feature(9)714..716
Misc Feature(10)714..716
Misc Feature(11)714..716
Misc Feature(12)1011..1133
Misc Feature(13)1071..1136
Misc Feature(14)1128..1148
Exon (1)1..153
Gene:CAMK1
Gene Synonym:CAMKI
Exon (2)154..268
Gene:CAMK1
Gene Synonym:CAMKI
Exon (3)269..400
Gene:CAMK1
Gene Synonym:CAMKI
Exon (4)401..475
Gene:CAMK1
Gene Synonym:CAMKI
Exon (5)476..614
Gene:CAMK1
Gene Synonym:CAMKI
Exon (6)615..741
Gene:CAMK1
Gene Synonym:CAMKI
Exon (7)742..817
Gene:CAMK1
Gene Synonym:CAMKI
Exon (8)818..930
Gene:CAMK1
Gene Synonym:CAMKI
Exon (9)931..1009
Gene:CAMK1
Gene Synonym:CAMKI
Exon (10)1010..1097
Gene:CAMK1
Gene Synonym:CAMKI
Exon (11)1098..1215
Gene:CAMK1
Gene Synonym:CAMKI
Exon (12)1216..1492
Gene:CAMK1
Gene Synonym:CAMKI
Translation MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKE GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACG TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP YWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK SKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCCCRDCCVEPGT ELSPTLPHQL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(134)-g, adbSNP:371839036
complement(157)-dbSNP:
complement(157)-t, gdbSNP:373157445
complement(173)-t, cdbSNP:200234296
complement(193)-t, cdbSNP:113139851
complement(201)-g, cdbSNP:201983776
complement(221)-t, cdbSNP:143334693
complement(224)-t, cdbSNP:142562247
complement(228)-t, cdbSNP:377569441
complement(242)-t, gdbSNP:372987743
complement(263)-t, cdbSNP:201089722
complement(268)-g, adbSNP:190639418
complement(281)-dbSNP:
complement(281)-t, cdbSNP:200472416
complement(366)-t, cdbSNP:77335822
complement(413)-dbSNP:
complement(413)-t, gdbSNP:148286667
complement(419)-g, adbSNP:138408472
complement(430)-t, cdbSNP:149094214
complement(439)-t, cdbSNP:138483154
complement(441)-c, adbSNP:200398091
complement(457)-c, adbSNP:375556446
complement(515)-dbSNP:
complement(515)-t, gdbSNP:151133089
complement(531)-g, adbSNP:143182946
complement(568)-g, adbSNP:186994904
complement(604)-t, cdbSNP:372278723
complement(716)-dbSNP:
complement(716)-g, adbSNP:377236766
complement(737)-g, adbSNP:145978414
complement(780)-dbSNP:
complement(780)-t, cdbSNP:148571810
complement(806)-g, adbSNP:56203420
complement(824)-dbSNP:
complement(824)-g, adbSNP:138951531
complement(840)-t, adbSNP:147073343
complement(884)-g, adbSNP:200459492
complement(890)-g, adbSNP:143557505
complement(914)-g, adbSNP:143142172
complement(917)-g, adbSNP:55722214
complement(923)-g, adbSNP:140837712
complement(945)-dbSNP:
complement(945)-g, adbSNP:372591129
complement(946)-c, adbSNP:139097636
complement(979)-g, adbSNP:200157460
complement(980)-g, adbSNP:367901510
complement(997)-g, adbSNP:199997024
complement(1002)-g, adbSNP:370718078
complement(1005)-g, adbSNP:148790679
complement(1014)-dbSNP:
complement(1014)-t, cdbSNP:372987286
complement(1052)-t, cdbSNP:139923053
complement(1061)-t, cdbSNP:150806322
complement(1092)-g, adbSNP:377182467
complement(1115)-dbSNP:
complement(1115)-t, cdbSNP:372117059
complement(1126)-t, cdbSNP:200156536
complement(1178)-t, cdbSNP:55983368
complement(1181)-c, adbSNP:141116659
complement(1186)-t, gdbSNP:201838059
complement(1199)-c, adbSNP:369091156
complement(1239)-g, adbSNP:200760015
complement(1266)-t, cdbSNP:56033923
complement(1302)-g, adbSNP:370595279
complement(1311)-g, adbSNP:200776296
complement(1313)-t, cdbSNP:371720443
complement(1343)-g, cdbSNP:377262589
complement(1373)-g, adbSNP:55801042
1408+c, tdbSNP:293795
complement(1419)-t, adbSNP:180919378
complement(1476)-g, cdbSNP:199602361
Gene SymbolCAMK1
Gene SynonymCAMKI
Chromosome3
Locus Map3p25.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003656 Homo sapiens calcium/calmodulin-dependent protein kinase I (CAMK1), mRNA. In-stock $99.00 5-7
XM_005265516 PREDICTED: Homo sapiens calcium/calmodulin-dependent protein kinase I (CAMK1), transcript variant X1, mRNA. On-demand $219.00 7-9
XM_005265517 PREDICTED: Homo sapiens calcium/calmodulin-dependent protein kinase I (CAMK1), transcript variant X2, mRNA. On-demand $219.00 7-9
Title Fbxl12 triggers G1 arrest by mediating degradation of calmodulin kinase I .
Author Mallampalli RK, Kaercher L, Snavely C, Pulijala R, Chen BB, Coon T, Zhao J and Agassandian M.
Journal Cell. Signal. 25 (10), 2047-2059 (2013)
Title Crystal structures of human CaMKIalpha reveal insights into the regulation mechanism of CaMKI .
Author Zha M, Zhong C, Ou Y, Han L, Wang J and Ding J.
Journal PLoS ONE 7 (9), E44828 (2012)
Title Aldosterone producing adrenal adenomas are characterized by activation of calcium/calmodulin-dependent protein kinase (CaMK) dependent pathways .
Author Sackmann S, Lichtenauer U, Shapiro I, Reincke M and Beuschlein F.
Journal Horm. Metab. Res. 43 (2), 106-111 (2011)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey SD, Xie C, Do R, Montpetit A, Diaz R, Mohan V, Keavney B, Yusuf S, Gerstein HC, Engert JC and Anand S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Association study of 182 candidate genes in anorexia nervosa .
Author Pinheiro AP, Bulik CM, Thornton LM, Sullivan PF, Root TL, Bloss CS, Berrettini WH, Schork NJ, Kaye WH, Bergen AW, Magistretti P, Brandt H, Crawford S, Crow S, Fichter MM, Goldman D, Halmi KA, Johnson C, Kaplan AS, Keel PK, Klump KL, La Via M, Mitchell JE, Strober M, Rotondo A, Treasure J and Woodside DB.
Journal Am. J. Med. Genet. B Neuropsychiatr. Genet. 153B (5), 1070-1080 (2010)
Title Characterization of substrate phosphorylation and use of calmodulin mutants to address implications from the enzyme crystal structure of calmodulin-dependent protein kinase I .
Author Chin D, Winkler KE and Means AR.
Journal J. Biol. Chem. 272 (50), 31235-31240 (1997)
Title The regulatory region of calcium/calmodulin-dependent protein kinase I contains closely associated autoinhibitory and calmodulin-binding domains .
Author Yokokura H, Picciotto MR, Nairn AC and Hidaka H.
Journal J. Biol. Chem. 270 (40), 23851-23859 (1995)
Title Human calcium-calmodulin dependent protein kinase I: cDNA cloning, domain structure and activation by phosphorylation at threonine-177 by calcium-calmodulin dependent protein kinase I kinase .
Author Haribabu B, Hook SS, Selbert MA, Goldstein EG, Tomhave ED, Edelman AM, Snyderman R and Means AR.
Journal EMBO J. 14 (15), 3679-3686 (1995)
Title Activating transcription factor-1 can mediate Ca(2+)- and cAMP-inducible transcriptional activation .
Author Liu F, Thompson MA, Wagner S, Greenberg ME and Green MR.
Journal J. Biol. Chem. 268 (9), 6714-6720 (1993)
Title Nitric oxide synthase regulatory sites. Phosphorylation by cyclic AMP-dependent protein kinase, protein kinase C, and calcium/calmodulin protein kinase; identification of flavin and calmodulin binding sites .
Author Bredt DS, Ferris CD and Snyder SH.
Journal J. Biol. Chem. 267 (16), 10976-10981 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.