• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens calcium/calmodulin-dependent protein kinase I (CAMK1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003656 Homo sapiens calcium/calmodulin-dependent protein kinase I (CAMK1), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_003656.4, 325995171
Length 1500 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens calcium/calmodulin-dependent protein kinase I (CAMK1), mRNA.
Product calcium/calmodulin-dependent protein kinase type 1
Comment

Summary: Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase. [provided by RefSeq, Jul 2008].

RefSeq NP_003647.1
CDS 186..1298
Misc Feature(1)81..83
Misc Feature(2)243..1013
Misc Feature(3)243..1013
Misc Feature(4)261..1010
Misc Feature(5)order(261..275,285..287,324..326,330..332,420..422,
Misc Feature(6)order(261..275,285..287,324..326,330..332,420..422,
Misc Feature(7)order(273..275,489..491,495..497,606..608,612..614,
Misc Feature(8)order(666..689,714..734)
Misc Feature(9)714..716
Misc Feature(10)714..716
Misc Feature(11)714..716
Misc Feature(12)1011..1133
Misc Feature(13)1071..1136
Misc Feature(14)1128..1148
Exon (1)1..153
Gene:CAMK1
Gene Synonym:CAMKI
Exon (2)154..268
Gene:CAMK1
Gene Synonym:CAMKI
Exon (3)269..400
Gene:CAMK1
Gene Synonym:CAMKI
Exon (4)401..475
Gene:CAMK1
Gene Synonym:CAMKI
Exon (5)476..614
Gene:CAMK1
Gene Synonym:CAMKI
Exon (6)615..741
Gene:CAMK1
Gene Synonym:CAMKI
Exon (7)742..817
Gene:CAMK1
Gene Synonym:CAMKI
Exon (8)818..930
Gene:CAMK1
Gene Synonym:CAMKI
Exon (9)931..1009
Gene:CAMK1
Gene Synonym:CAMKI
Exon (10)1010..1097
Gene:CAMK1
Gene Synonym:CAMKI
Exon (11)1098..1215
Gene:CAMK1
Gene Synonym:CAMKI
Exon (12)1216..1492
Gene:CAMK1
Gene Synonym:CAMKI
Translation MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKE GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACG TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP YWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK SKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCCCRDCCVEPGT ELSPTLPHQL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(173)-dbSNP:
complement(173)-t, cdbSNP:200234296
complement(193)-t, cdbSNP:113139851
complement(201)-g, cdbSNP:201983776
complement(221)-t, cdbSNP:143334693
complement(224)-t, cdbSNP:142562247
complement(263)-t, cdbSNP:201089722
complement(268)-g, adbSNP:190639418
complement(281)-dbSNP:
complement(281)-t, cdbSNP:200472416
complement(366)-t, cdbSNP:77335822
complement(413)-dbSNP:
complement(413)-t, gdbSNP:148286667
complement(419)-g, adbSNP:138408472
complement(430)-t, cdbSNP:149094214
complement(439)-t, cdbSNP:138483154
complement(441)-c, adbSNP:200398091
complement(515)-dbSNP:
complement(515)-t, gdbSNP:151133089
complement(531)-g, adbSNP:143182946
complement(568)-g, adbSNP:186994904
complement(737)-dbSNP:
complement(737)-g, adbSNP:145978414
complement(780)-dbSNP:
complement(780)-t, cdbSNP:148571810
complement(806)-g, adbSNP:56203420
complement(824)-dbSNP:
complement(824)-g, adbSNP:138951531
complement(833)-c, adbSNP:147237334
complement(840)-t, adbSNP:147073343
complement(884)-g, adbSNP:200459492
complement(887)-t, cdbSNP:140829275
complement(890)-g, adbSNP:143557505
complement(914)-g, adbSNP:143142172
complement(917)-g, adbSNP:55722214
complement(923)-g, adbSNP:140837712
complement(946)-dbSNP:
complement(946)-g, cdbSNP:139097636
complement(979)-g, adbSNP:200157460
complement(997)-g, adbSNP:199997024
complement(999)-t, gdbSNP:150868701
complement(1005)-g, adbSNP:148790679
complement(1052)-dbSNP:
complement(1052)-t, cdbSNP:139923053
complement(1061)-t, cdbSNP:150806322
complement(1126)-dbSNP:
complement(1126)-t, cdbSNP:200156536
complement(1178)-t, cdbSNP:55983368
complement(1181)-c, adbSNP:141116659
complement(1186)-t, gdbSNP:201838059
complement(1239)-g, adbSNP:200760015
complement(1266)-t, cdbSNP:56033923
complement(1311)-g, adbSNP:200776296
complement(1373)-g, adbSNP:55801042
complement(1408)-t, cdbSNP:293795
complement(1419)-t, adbSNP:180919378
complement(1476)-g, cdbSNP:199602361
Gene SymbolCAMK1
Gene SynonymCAMKI
Chromosome3
Locus Map3p25.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003656 Homo sapiens calcium/calmodulin-dependent protein kinase I (CAMK1), mRNA. In-stock $418.00 $369.00 10
Title Crystal structures of human CaMKIalpha reveal insights into the regulation mechanism of CaMKI .
Author Zha,M., Zhong,C., Ou,Y., Han,L., Wang,J. and Ding,J.
Journal PLoS ONE 7 (9), E44828 (2012)
Title Aldosterone producing adrenal adenomas are characterized by activation of calcium/calmodulin-dependent protein kinase (CaMK) dependent pathways .
Author Sackmann,S., Lichtenauer,U., Shapiro,I., Reincke,M. and Beuschlein,F.
Journal Horm. Metab. Res. 43 (2), 106-111 (2011)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Association study of 182 candidate genes in anorexia nervosa .
Author Pinheiro,A.P., Bulik,C.M., Thornton,L.M., Sullivan,P.F., Root,T.L., Bloss,C.S., Berrettini,W.H., Schork,N.J., Kaye,W.H., Bergen,A.W., Magistretti,P., Brandt,H., Crawford,S., Crow,S., Fichter,M.M., Goldman,D., Halmi,K.A., Johnson,C., Kaplan,A.S., Keel,P.K., Klump,K.L., La Via,M., Mitchell,J.E., Strober,M., Rotondo,A., Treasure,J. and Woodside,D.B.
Journal Am. J. Med. Genet. B Neuropsychiatr. Genet. 153B (5), 1070-1080 (2010)
Title Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip .
Author Talmud,P.J., Drenos,F., Shah,S., Shah,T., Palmen,J., Verzilli,C., Gaunt,T.R., Pallas,J., Lovering,R., Li,K., Casas,J.P., Sofat,R., Kumari,M., Rodriguez,S., Johnson,T., Newhouse,S.J., Dominiczak,A., Samani,N.J., Caulfield,M., Sever,P., Stanton,A., Shields,D.C., Padmanabhan,S., Melander,O., Hastie,C., Delles,C., Ebrahim,S., Marmot,M.G., Smith,G.D., Lawlor,D.A., Munroe,P.B., Day,I.N., Kivimaki,M., Whittaker,J., Humphries,S.E. and Hingorani,A.D.
Journal Am. J. Hum. Genet. 85 (5), 628-642 (2009)
Title Characterization of substrate phosphorylation and use of calmodulin mutants to address implications from the enzyme crystal structure of calmodulin-dependent protein kinase I .
Author Chin,D., Winkler,K.E. and Means,A.R.
Journal J. Biol. Chem. 272 (50), 31235-31240 (1997)
Title The regulatory region of calcium/calmodulin-dependent protein kinase I contains closely associated autoinhibitory and calmodulin-binding domains .
Author Yokokura,H., Picciotto,M.R., Nairn,A.C. and Hidaka,H.
Journal J. Biol. Chem. 270 (40), 23851-23859 (1995)
Title Human calcium-calmodulin dependent protein kinase I: cDNA cloning, domain structure and activation by phosphorylation at threonine-177 by calcium-calmodulin dependent protein kinase I kinase .
Author Haribabu,B., Hook,S.S., Selbert,M.A., Goldstein,E.G., Tomhave,E.D., Edelman,A.M., Snyderman,R. and Means,A.R.
Journal EMBO J. 14 (15), 3679-3686 (1995)
Title Activating transcription factor-1 can mediate Ca(2+)- and cAMP-inducible transcriptional activation .
Author Liu,F., Thompson,M.A., Wagner,S., Greenberg,M.E. and Green,M.R.
Journal J. Biol. Chem. 268 (9), 6714-6720 (1993)
Title Nitric oxide synthase regulatory sites. Phosphorylation by cyclic AMP-dependent protein kinase, protein kinase C, and calcium/calmodulin protein kinase; identification of flavin and calmodulin binding sites .
Author Bredt,D.S., Ferris,C.D. and Snyder,S.H.
Journal J. Biol. Chem. 267 (16), 10976-10981 (1992)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.