• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens titin-cap (TCAP), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18837 Homo sapiens titin-cap (TCAP), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu18837C Homo sapiens titin-cap (TCAP), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_003673.3, 209862803
Length 504 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens titin-cap (TCAP), mRNA.
Product telethonin
Comment

Summary: Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. This gene encodes a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in this gene are associated with limb-girdle muscular dystrophy type 2G. [provided by RefSeq, Jul 2008].

RefSeq NP_003664.1
CDS 15..518
Misc Feature(1)3..5
Misc Feature(2)15..515
Misc Feature(3)15..515
Misc Feature(4)483..485
Misc Feature(5)483..485
Exon (1)1..124
Gene:TCAP
Gene Synonym:CMD1N; LGMD2G; T-cap; TELE; telethonin
Exon (2)125..963
Gene:TCAP
Gene Synonym:CMD1N; LGMD2G; T-cap; TELE; telethonin
Translation MATSELSCEVSEENCERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHQQGQCQVL VQRSPWLMMRMGILGRGLQEYQLPYQRVLPLPIFTPAKMGATKEEREDTPIQLQELLALE TALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSMSQEAQRG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
2+dbSNP:
2+a, gdbSNP:368175926
complement(3)-t, c, adbSNP:77831798
30+a, cdbSNP:201664428
46+c, tdbSNP:45495192
51..53+, gagdbSNP:397516862
67+a, gdbSNP:45614536
74+c, gdbSNP:146502276
80+a, gdbSNP:141019458
101+a, gdbSNP:144741021
111+c, tdbSNP:145524909
127+dbSNP:
127+g, tdbSNP:375310569
146+c, tdbSNP:397516861
159+a, gdbSNP:45513698
171+c, tdbSNP:104894655
185+c, gdbSNP:369447207
205+c, tdbSNP:45458802
209+c, gdbSNP:370118201
226+c, tdbSNP:143465226
235+a, tdbSNP:17851031
274+a, gdbSNP:121434298
275+g, tdbSNP:375389509
284+a, gdbSNP:372538567
290+c, tdbSNP:147979713
291+g, tdbSNP:76130885
293+c, tdbSNP:144149447
314+c, tdbSNP:187261074
327+c, gdbSNP:146906267
330+c, tdbSNP:45578741
351+c, tdbSNP:372312912
367+c, tdbSNP:143233087
402+c, tdbSNP:374886575
403+a, gdbSNP:147503632
435+c, gdbSNP:45509691
461+c, tdbSNP:45614332
467+a, cdbSNP:1053651
472+a, gdbSNP:149585781
486+a, cdbSNP:397516863
487+a, gdbSNP:397516864
507+c, gdbSNP:397516865
534+a, gdbSNP:45495400
540+c, tdbSNP:200333339
550+a, gdbSNP:375843419
572+a, gdbSNP:45592941
594+g, tdbSNP:45506294
717+g, tdbSNP:45503594
810+a, gdbSNP:185210946
823+a, gdbSNP:45521334
863+a, cdbSNP:372376824
876+a, gdbSNP:188530675
895+a, c, gdbSNP:3194794
913+c, tdbSNP:45540732
936+c, tdbSNP:45500896
954..955+, atdbSNP:45459794
Gene SymbolTCAP
Gene SynonymCMD1N; LGMD2G; T-cap; TELE; telethonin
Chromosome17
Locus Map17q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003673 Homo sapiens titin-cap (TCAP), mRNA. On-demand $159.00 7-9
Title Phosphoregulation of the titin-cap protein telethonin in cardiac myocytes .
Author Candasamy AJ, Haworth RS, Cuello F, Ibrahim M, Aravamudhan S, Kruger M, Holt MR, Terracciano CM, Mayr M, Gautel M and Avkiran M.
Journal J. Biol. Chem. 289 (3), 1282-1293 (2014)
Title A study of FHL1, BAG3, MATR3, PTRF and TCAP in Australian muscular dystrophy patients .
Author Waddell LB, Tran J, Zheng XF, Bonnemann CG, Hu Y, Evesson FJ, Lek M, Arbuckle S, Wang MX, Smith RL, North KN and Clarke NF.
Journal Neuromuscul. Disord. 21 (11), 776-781 (2011)
Title Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol? .
Author Ruano G, Thompson PD, Kane JP, Pullinger CR, Windemuth A, Seip RL, Kocherla M, Holford TR and Wu AH.
Journal Pharmacogenomics 11 (7), 959-971 (2010)
Title A novel custom resequencing array for dilated cardiomyopathy .
Author Zimmerman RS, Cox S, Lakdawala NK, Cirino A, Mancini-DiNardo D, Clark E, Leon A, Duffy E, White E, Baxter S, Alaamery M, Farwell L, Weiss S, Seidman CE, Seidman JG, Ho CY, Rehm HL and Funke BH.
Journal Genet. Med. 12 (5), 268-278 (2010)
Title Structural basis for activation of the titin kinase domain during myofibrillogenesis .
Author Mayans O, van der Ven PF, Wilm M, Mues A, Young P, Furst DO, Wilmanns M and Gautel M.
Journal Nature 395 (6705), 863-869 (1998)
Title Two immunoglobulin-like domains of the Z-disc portion of titin interact in a conformation-dependent way with telethonin .
Author Mues A, van der Ven PF, Young P, Furst DO and Gautel M.
Journal FEBS Lett. 428 (1-2), 111-114 (1998)
Title Telethonin, a novel sarcomeric protein of heart and skeletal muscle .
Author Valle G, Faulkner G, De Antoni A, Pacchioni B, Pallavicini A, Pandolfo D, Tiso N, Toppo S, Trevisan S and Lanfranchi G.
Journal FEBS Lett. 415 (2), 163-168 (1997)
Title The seventh form of autosomal recessive limb-girdle muscular dystrophy is mapped to 17q11-12 .
Author Moreira ES, Vainzof M, Marie SK, Sertie AL, Zatz M and Passos-Bueno MR.
Journal Am. J. Hum. Genet. 61 (1), 151-159 (1997)
Title Hypertrophic Cardiomyopathy Overview .
Author Cirino,A.L. and Ho,C.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Dilated Cardiomyopathy Overview .
Author Hershberger,R.E. and Morales,A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.