• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens calcium/calmodulin-dependent serine protein kinase (MAGUK family) (CASK), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27417 Homo sapiens calcium/calmodulin-dependent serine protein kinase (MAGUK family) (CASK), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu27417C Homo sapiens calcium/calmodulin-dependent serine protein kinase (MAGUK family) (CASK), transcript variant 1, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_003688.3, 193788694
Length 2766 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens calcium/calmodulin-dependent serine protein kinase (MAGUK family) (CASK), transcript variant 1, mRNA.
Product peripheral plasma membrane protein CASK isoform 1
Comment

Summary: This gene encodes a calcium/calmodulin-dependent serine protein kinase. The encoded protein is a MAGUK (membrane-associated guanylate kinase) protein family member. These proteins are scaffold proteins and the encoded protein is located at synapses in the brain. Mutations in this gene are associated with FG syndrome 4, mental retardation and microcephaly with pontine and cerebellar hypoplasia, and a form of X-linked mental retardation. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2010].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest protein (isoform 1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_003679.2
CDS 47..2812
Misc Feature(1)80..874
Misc Feature(2)80..874
Misc Feature(3)80..868
Misc Feature(4)order(98..112,122..124,161..163,167..169,269..271,
Misc Feature(5)order(98..112,122..124,161..163,167..169,269..271,
Misc Feature(6)order(110..112,338..340,344..346,467..469,473..475,
Misc Feature(7)497..499
Misc Feature(8)509..511
Misc Feature(9)order(527..547,587..598)
Misc Feature(10)959..991
Misc Feature(11)1082..1237
Misc Feature(12)1259..1408
Misc Feature(13)1508..1750
Misc Feature(14)order(1544..1555,1559..1561,1700..1705,1712..1717)
Misc Feature(15)1892..2077
Misc Feature(16)order(1898..1900,1970..1975)
Misc Feature(17)order(1907..1909,1913..1915,1922..1924,1955..1957,
Misc Feature(18)2243..2764
Misc Feature(19)2255..2752
Misc Feature(20)order(2267..2269,2285..2287,2336..2338,2357..2359,
Misc Feature(21)order(2267..2269,2285..2287)
Exon (1)1..105
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (2)106..218
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (3)219..324
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (4)325..402
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (5)403..475
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (6)476..578
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (7)579..754
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (8)755..877
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (9)878..961
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (10)962..1061
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (11)1062..1079
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (12)1080..1201
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (13)1202..1279
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (14)1280..1360
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (15)1361..1549
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (16)1550..1628
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (17)1629..1714
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (18)1715..1783
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (19)1784..1852
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (20)1853..1888
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (21)1889..2085
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (22)2086..2201
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (23)2202..2267
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (24)2268..2348
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (25)2349..2551
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (26)2552..2635
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Exon (27)2636..8298
Gene:CASK
Gene Synonym:CAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
Translation MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLK REASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASH YMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRV GTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPR QWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNA RRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHAL TDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYP ENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDM DMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREIN GISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNS VSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNADL VTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENG KNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVL RTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRH LEEAVELVCTAPQWVPVSWVY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(15)-dbSNP:
complement(15)-g, cdbSNP:375116135
complement(41)-g, adbSNP:200206294
complement(88)-g, cdbSNP:377590077
129+dbSNP:
129+g, tdbSNP:137852816
complement(319)-dbSNP:
complement(319)-g, adbSNP:201151046
complement(349)-dbSNP:
complement(349)-g, adbSNP:373431768
362+c, tdbSNP:387906704
409+dbSNP:
409+c, tdbSNP:41431245
complement(436)-g, adbSNP:143067717
complement(445)-g, adbSNP:149041843
complement(646)-dbSNP:
complement(646)-t, cdbSNP:147738759
complement(835)-dbSNP:
complement(835)-t, cdbSNP:113160327
complement(844)-c, adbSNP:377105525
848+c, tdbSNP:137852817
961+dbSNP:
961+a, gdbSNP:387906499
complement(994)-t, cdbSNP:376360424
complement(1067)-dbSNP:
complement(1067)-g, cdbSNP:368238302
complement(1123)-dbSNP:
complement(1123)-t, cdbSNP:145641295
complement(1171)-g, adbSNP:141790702
1232+dbSNP:
1232+c, tdbSNP:137852820
complement(1315)-dbSNP:
complement(1315)-g, adbSNP:17315800
complement(1334)-g, adbSNP:149798861
complement(1335)-t, cdbSNP:139731261
complement(1358)-t, gdbSNP:150618425
complement(1415)-dbSNP:
complement(1415)-g, adbSNP:371870820
complement(1438)-g, adbSNP:368007414
complement(1457)-t, cdbSNP:201435578
complement(1467)-t, gdbSNP:144185999
complement(1477)-g, adbSNP:375029309
1482+a, gdbSNP:1141273
complement(1522)-t, cdbSNP:199737893
complement(1555)-dbSNP:
complement(1555)-t, gdbSNP:139491124
complement(1573)-t, gdbSNP:370547220
complement(1606)-g, adbSNP:376502341
1685+c, tdbSNP:387906705
complement(1696)-t, cdbSNP:377659556
complement(1761)-dbSNP:
complement(1761)-t, cdbSNP:146282743
complement(1764)-g, adbSNP:141840001
complement(1774)-t, cdbSNP:56199880
complement(1831)-dbSNP:
complement(1831)-t, gdbSNP:148258628
complement(1840)-g, adbSNP:143991107
complement(1936)-dbSNP:
complement(1936)-g, adbSNP:267606457
1961+c, tdbSNP:137852815
complement(1968)-t, cdbSNP:76106850
complement(1986)-t, cdbSNP:113560066
complement(2044)-g, adbSNP:113567434
2069+c, tdbSNP:1141274
2175+dbSNP:
2175+a, gdbSNP:137852818
complement(2201)-c, adbSNP:12842195
complement(2201)-c, adbSNP:386526210
complement(2203)-dbSNP:
complement(2203)-g, adbSNP:199730401
2214+a, gdbSNP:398122844
complement(2245)-c, adbSNP:199765605
complement(2327)-dbSNP:
complement(2327)-g, cdbSNP:373953251
complement(2328)-t, cdbSNP:137964936
2348+c, tdbSNP:398123811
2370+dbSNP:
2370+a, gdbSNP:1141275
complement(2374)-g, adbSNP:55642200
complement(2411)-t, cdbSNP:146936770
complement(2440)-g, adbSNP:375034853
complement(2464)-g, adbSNP:371990384
complement(2473)-t, cdbSNP:141158465
complement(2501)-g, adbSNP:369792621
complement(2502)-t, cdbSNP:138646715
complement(2513)-c, adbSNP:192044507
complement(2539)-g, adbSNP:375734729
complement(2620)-dbSNP:
complement(2620)-t, adbSNP:367611761
complement(2757)-t, gdbSNP:192186529
complement(2767)-g, adbSNP:147125272
complement(2768)-t, cdbSNP:374765049
2786+c, tdbSNP:137852819
complement(2828)-g, adbSNP:369730218
complement(2848)-g, adbSNP:371773454
complement(3342)-g, adbSNP:188484697
complement(3421)-, gdbSNP:372562683
complement(3542)-g, cdbSNP:140657031
complement(4396)-g, adbSNP:184249905
complement(4621)-t, cdbSNP:41310603
complement(4632)-g, adbSNP:192576790
complement(4633)-t, cdbSNP:373349122
complement(4675)-, adbSNP:367659042
complement(4689)-g, adbSNP:187703004
complement(4749)-t, adbSNP:184049666
complement(4787)-t, cdbSNP:369096388
complement(4815)-g, cdbSNP:193144081
complement(4929)-t, cdbSNP:150270650
complement(5131)-t, cdbSNP:41310657
complement(5143)-g, cdbSNP:371092524
complement(5178)-g, adbSNP:41310645
complement(5234)-t, gdbSNP:41309743
complement(5261)-g, cdbSNP:41298460
complement(5263)-t, cdbSNP:187800971
complement(5459..5461)-, agcdbSNP:373596823
complement(5462)-t, cdbSNP:182727366
complement(5476)-t, cdbSNP:147899054
complement(5552..5553)-, adbSNP:370477231
complement(5707)-t, gdbSNP:41310597
complement(5805)-g, adbSNP:73470557
complement(5987)-t, cdbSNP:374924217
complement(6005)-t, gdbSNP:190590653
complement(6095)-t, cdbSNP:371417921
complement(6241)-g, adbSNP:368866752
complement(6289)-t, cdbSNP:143986200
complement(6291)-c, adbSNP:185335561
complement(6324)-t, cdbSNP:376774093
complement(6484)-t, cdbSNP:5917432
complement(6501)-g, cdbSNP:182653355
complement(6564)-c, adbSNP:190946012
complement(6574)-t, cdbSNP:372182896
complement(6636)-t, cdbSNP:186139866
complement(6662)-g, cdbSNP:41312112
complement(6665)-g, cdbSNP:182354197
complement(7289)-t, cdbSNP:55749198
complement(7356)-t, cdbSNP:5918193
complement(7461)-g, cdbSNP:368493915
complement(7580)-g, adbSNP:190219889
complement(7595)-g, cdbSNP:186443661
complement(7682)-t, cdbSNP:141511149
complement(7714)-c, adbSNP:181506008
complement(7789)-t, cdbSNP:189124477
complement(7962)-t, cdbSNP:5918192
complement(8057)-g, adbSNP:145967324
8088+c, tdbSNP:3203642
complement(8091)-g, adbSNP:373192884
complement(8106)-t, cdbSNP:10126166
Gene SymbolCASK
Gene SynonymCAGH39; CAMGUK; CMG; FGS4; LIN2; MICPCH; MRXSNA; TNRC8
ChromosomeX
Locus MapXp11.4
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003688 Homo sapiens calcium/calmodulin-dependent serine protein kinase (MAGUK family) (CASK), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_003688 Homo sapiens calcium/calmodulin-dependent serine protein kinase (MAGUK family) (CASK), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_003688 Homo sapiens calcium/calmodulin-dependent serine protein kinase (MAGUK family) (CASK), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_003688 Homo sapiens calcium/calmodulin-dependent serine protein kinase (MAGUK family) (CASK), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_003688 Homo sapiens calcium/calmodulin-dependent serine protein kinase (MAGUK family) (CASK), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_003688 Homo sapiens calcium/calmodulin-dependent serine protein kinase (MAGUK family) (CASK), transcript variant 1, mRNA. On-demand $279.00 12-14
Title CASK regulates SAP97 conformation and its interactions with AMPA and NMDA receptors .
Author Lin EI, Jeyifous O and Green WN.
Journal J. Neurosci. 33 (29), 12067-12076 (2013)
Title Calcium/calmodulin-dependent serine protein kinase (CASK) is a new intracellular modulator of P2X3 receptors .
Author Gnanasekaran A, Sundukova M, Hullugundi S, Birsa N, Bianchini G, Hsueh YP, Nistri A and Fabbretti E.
Journal J. Neurochem. 126 (1), 102-112 (2013)
Title CASK and CaMKII function in the mushroom body alpha'/beta' neurons during Drosophila memory formation .
Author Malik BR, Gillespie JM and Hodge JJ.
Journal Front Neural Circuits 7, 52 (2013)
Title Mapping and expression analysis of the human CASK gene .
Author Stevenson D, Laverty HG, Wenwieser S, Douglas M and Wilson JB.
Journal Mamm. Genome 11 (10), 934-937 (2000)
Title The location of human CASK at Xp11.4 identifies this gene as a candidate for X-linked optic atrophy .
Author Dimitratos SD, Stathakis DG, Nelson CA, Woods DF and Bryant PJ.
Journal Genomics 51 (2), 308-309 (1998)
Title Human CASK/LIN-2 binds syndecan-2 and protein 4.1 and localizes to the basolateral membrane of epithelial cells .
Author Cohen AR, Woods DF, Marfatia SM, Walther Z, Chishti AH and Anderson JM.
Journal J. Cell Biol. 142 (1), 129-138 (1998)
Title Crystal structure of the hCASK PDZ domain reveals the structural basis of class II PDZ domain target recognition .
Author Daniels DL, Cohen AR, Anderson JM and Brunger AT.
Journal Nat. Struct. Biol. 5 (4), 317-325 (1998)
Title cDNAs with long CAG trinucleotide repeats from human brain .
Author Margolis RL, Abraham MR, Gatchell SB, Li SH, Kidwai AS, Breschel TS, Stine OC, Callahan C, McInnis MG and Ross CA.
Journal Hum. Genet. 100 (1), 114-122 (1997)
Title CASK: a novel dlg/PSD95 homolog with an N-terminal calmodulin-dependent protein kinase domain identified by interaction with neurexins .
Author Hata Y, Butz S and Sudhof TC.
Journal J. Neurosci. 16 (8), 2488-2494 (1996)
Title CASK-Related Disorders .
Author Moog,U., Uyanik,G. and Kutsche,K.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.