• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor protein p63 (TP63), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003722 Homo sapiens tumor protein p63 (TP63), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_003722.4, 169234655
Length 4927 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tumor protein p63 (TP63), transcript variant 1, mRNA.
Product tumor protein 63 isoform 1
Comment

Summary: This gene encodes a member of the p53 family of transcription factors. An animal model, p63 -/- mice, has been useful in defining the role this protein plays in the development and maintenance of stratified epithelial tissues. p63 -/- mice have several developmental defects which include the lack of limbs and other tissues, such as teeth and mammary glands, which develop as a result of interactions between mesenchyme and epithelium. Mutations in this gene are associated with ectodermal dysplasia, and cleft lip/palate syndrome 3 (EEC3); split-hand/foot malformation 4 (SHFM4); ankyloblepharon-ectodermal defects-cleft lip/palate; ADULT syndrome (acro-dermato-ungual-lacrimal-tooth); limb-mammary syndrome; Rap-Hodgkin syndrome (RHS); and orofacial cleft 8. Both alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different proteins. Many transcripts encoding different proteins have been reported but the biological validity and the full-length nature of these variants have not been determined. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) is the longest transcript and encodes the longest protein (isoform 1, also known as TAp63alpha, KET and p51B).

RefSeq NP_003713.3
CDS 90..2132
Misc Feature(1)66..68
Misc Feature(2)90..410
Misc Feature(3)90..410
Misc Feature(4)618..1163
Misc Feature(5)order(819..821,828..830,1011..1013,1023..1025)
Misc Feature(6)order(822..830,834..836)
Misc Feature(7)order(1014..1016,1020..1022,1041..1043,1116..1118,
Misc Feature(8)1143..1253
Misc Feature(9)1263..1385
Misc Feature(10)1269..1418
Misc Feature(11)1710..1904
Misc Feature(12)1716..1910
Misc Feature(13)1917..2129
Exon (1)1..151
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (2)152..280
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (3)281..413
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (4)414..668
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (5)669..855
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (6)856..971
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (7)972..1081
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (8)1082..1218
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (9)1219..1301
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (10)1302..1438
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (11)1439..1596
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (12)1597..1741
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (13)1742..1835
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (14)1836..4909
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Translation MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWD FLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSM DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR KQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQ LINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPP PPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG ILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWND FNFDMDARRNKQQRIKEEGE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
4+dbSNP:
4+a, gdbSNP:147353819
32+a, tdbSNP:28673064
75+a, gdbSNP:200935681
138+c, gdbSNP:200000559
156+dbSNP:
156+a, gdbSNP:144315591
198+c, tdbSNP:147340040
206+c, tdbSNP:139505005
266+a, gdbSNP:151051217
287+dbSNP:
287+a, cdbSNP:142452541
299+c, gdbSNP:201631366
349+a, cdbSNP:71308973
378+c, tdbSNP:121908848
392+a, gdbSNP:186864205
450+dbSNP:
450+a, gdbSNP:111466227
455+a, gdbSNP:201774402
475+c, tdbSNP:193287780
476+a, gdbSNP:151335217
488+c, tdbSNP:145730343
491+c, tdbSNP:201239102
521+a, gdbSNP:200459305
533+c, gdbSNP:150028891
587+c, tdbSNP:146612442
593+c, tdbSNP:141278696
607+a, gdbSNP:113993965
610+c, tdbSNP:201188464
647+c, tdbSNP:200355416
766+dbSNP:
766+a, gdbSNP:193921145
767+c, tdbSNP:61732782
777+c, gdbSNP:201466089
786+a, gdbSNP:121908838
788+a, gdbSNP:199727371
800+c, tdbSNP:199686014
814+a, gdbSNP:201617537
816+c, tdbSNP:121908835
817+a, gdbSNP:121908836
886+dbSNP:
886+a, gdbSNP:121908849
898+a, cdbSNP:79939938
928+a, tdbSNP:190865056
948+c, tdbSNP:33979049
1001+dbSNP:
1001+a, gdbSNP:34119860
1042+a, gdbSNP:121908840
1044+c, tdbSNP:121908839
1098+dbSNP:
1098+c, gdbSNP:113993966
1099+a, gdbSNP:113993967
1117+a, gdbSNP:121908841
1122+c, tdbSNP:121908837
1141+a, gdbSNP:121908844
1143+a, gdbSNP:121908847
1151+a, gdbSNP:34841666
1172+a, gdbSNP:148937466
1183+c, tdbSNP:147148566
1191+a, gdbSNP:201706554
1210+c, tdbSNP:199807776
1216+a, gdbSNP:143591434
1219+dbSNP:
1219+c, tdbSNP:148052765
1250+a, gdbSNP:140374868
1331+dbSNP:
1331+a, gdbSNP:188455234
1410+c, tdbSNP:200973739
1456+dbSNP:
1456+c, tdbSNP:201479097
1457+a, gdbSNP:200558415
1463+a, gdbSNP:141794685
1474+a, gdbSNP:147181964
1478+a, cdbSNP:200802571
1502+c, tdbSNP:139407263
1554+a, gdbSNP:138832017
1569+a, gdbSNP:200203171
1602+dbSNP:
1602+a, gdbSNP:183154960
1619+g, tdbSNP:200578530
1620+a, cdbSNP:148076109
1664+c, tdbSNP:147389337
1670+c, tdbSNP:61752082
1676+c, tdbSNP:141847552
1735+c, tdbSNP:121908845
1748+dbSNP:
1748+a, tdbSNP:121908842
1764+c, tdbSNP:200463179
1769+a, gdbSNP:149465507
1770+g, tdbSNP:121908843
1796+a, gdbSNP:202009057
1806+a, gdbSNP:143884625
1827+c, tdbSNP:121908846
1877+dbSNP:
1877+a, gdbSNP:148577576
1903+a, gdbSNP:142981128
1914+a, gdbSNP:142762485
1916+a, gdbSNP:147538847
1935+, cdbSNP:113993964
2037+a, gdbSNP:140149400
2042..2043+, tdbSNP:35067146
2094+c, tdbSNP:143676789
2110+a, g, tdbSNP:34713855
2123+a, gdbSNP:140508531
2148+c, gdbSNP:201978861
2177+c, tdbSNP:34057105
2209+c, tdbSNP:140051057
2505+c, gdbSNP:188132962
2511+a, tdbSNP:192879052
2567+c, tdbSNP:78233713
2603+a, tdbSNP:144018872
2673+a, gdbSNP:73199799
2759+c, tdbSNP:184452906
2770+c, gdbSNP:6444406
2986+a, gdbSNP:187751631
3029+a, gdbSNP:35263259
3109+a, tdbSNP:192558999
3305+c, tdbSNP:184547631
3393+g, tdbSNP:201329652
3475+c, tdbSNP:35659283
3518+c, tdbSNP:35785527
3558+c, tdbSNP:36099321
3653+c, tdbSNP:181693641
3732+c, gdbSNP:35896507
3752+c, tdbSNP:34328757
3887+c, gdbSNP:185247541
3910+c, tdbSNP:189729625
3960+c, tdbSNP:149875270
3975..3976+, adbSNP:146332971
4045+a, gdbSNP:181220329
4057+c, gdbSNP:144916141
4071+, tdbSNP:140654135
4075+c, tdbSNP:116568110
4113+a, gdbSNP:186045329
4134+g, tdbSNP:35969817
4148+a, gdbSNP:115660354
4155+c, tdbSNP:189721510
4255+c, tdbSNP:36064124
4271+a, gdbSNP:35356690
4282+a, gdbSNP:181958566
4348+a, gdbSNP:35861864
4363..4364+, gdbSNP:35796357
4416+c, tdbSNP:146760848
4450+a, gdbSNP:199834330
4477+c, g, tdbSNP:35592567
4609+g, tdbSNP:186295449
4670+, tdbSNP:201395656
4757+a, tdbSNP:35694511
4768+, adbSNP:5855278
4818+c, tdbSNP:151060923
Gene SymbolTP63
Gene SynonymAIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Chromosome3
Locus Map3q28
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001114978 Homo sapiens tumor protein p63 (TP63), transcript variant 2, mRNA. On-demand $699.00 18
NM_001114979 Homo sapiens tumor protein p63 (TP63), transcript variant 3, mRNA. On-demand $699.00 18
NM_001114980 Homo sapiens tumor protein p63 (TP63), transcript variant 4, mRNA. On-demand $849.00 20
NM_001114981 Homo sapiens tumor protein p63 (TP63), transcript variant 5, mRNA. On-demand $699.00 18
NM_001114982 Homo sapiens tumor protein p63 (TP63), transcript variant 6, mRNA. On-demand $549.00 14
NM_003722 Homo sapiens tumor protein p63 (TP63), transcript variant 1, mRNA. On-demand $849.00 20
Title The p63 protein isoform DeltaNp63alpha inhibits epithelial-mesenchymal transition in human bladder cancer cells: role of MIR-205 .
Author Tran,M.N., Choi,W., Wszolek,M.F., Navai,N., Lee,I.L., Nitti,G., Wen,S., Flores,E.R., Siefker-Radtke,A., Czerniak,B., Dinney,C., Barton,M. and McConkey,D.J.
Journal J. Biol. Chem. 288 (5), 3275-3288 (2013)
Title DeltaNp63alpha-mediated activation of bone morphogenetic protein signaling governs stem cell activity and plasticity in normal and malignant mammary epithelial cells .
Author Balboni,A.L., Hutchinson,J.A., DeCastro,A.J., Cherukuri,P., Liby,K., Sporn,M.B., Schwartz,G.N., Wells,W.A., Sempere,L.F., Yu,P.B. and DiRenzo,J.
Journal Cancer Res. 73 (2), 1020-1030 (2013)
Title p40: a p63 isoform useful for lung cancer diagnosis - a review of the physiological and pathological role of p63 .
Author Nobre,A.R., Albergaria,A. and Schmitt,F.
Journal Acta Cytol. 57 (1), 1-8 (2013)
Title alpha6 Integrin and CD44 enrich for a primary keratinocyte population that displays resistance to UV-induced apoptosis .
Author Wray,H., Mackenzie,I.C., Storey,A. and Navsaria,H.
Journal PLoS ONE 7 (10), E46968 (2012)
Title The miR-17 family links p63 protein to MAPK signaling to promote the onset of human keratinocyte differentiation .
Author Wu,N., Sulpice,E., Obeid,P., Benzina,S., Kermarrec,F., Combe,S. and Gidrol,X.
Journal PLoS ONE 7 (9), E45761 (2012)
Title Cloning and functional analysis of human p51, which structurally and functionally resembles p53 .
Author Osada,M., Ohba,M., Kawahara,C., Ishioka,C., Kanamaru,R., Katoh,I., Ikawa,Y., Nimura,Y., Nakagawara,A., Obinata,M. and Ikawa,S.
Journal Nat. Med. 4 (7), 839-843 (1998)
Title A new human p53 homologue .
Author Trink,B., Okami,K., Wu,L., Sriuranpong,V., Jen,J. and Sidransky,D.
Journal Nat. Med. 4 (7), 747-748 (1998)
Title Non-p53 p53RE binding protein, a human transcription factor functionally analogous to P53 .
Author Zeng,X., Levine,A.J. and Lu,H.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (12), 6681-6686 (1998)
Title p53CP, a putative p53 competing protein that specifically binds to the consensus p53 DNA binding sites: a third member of the p53 family? .
Author Bian,J. and Sun,Y.
Journal Proc. Natl. Acad. Sci. U.S.A. 94 (26), 14753-14758 (1997)
Title Characterization of Grb2-binding proteins in human platelets activated by Fc gamma RIIA cross-linking .
Author Robinson,A., Gibbins,J., Rodriguez-Linares,B., Finan,P.M., Wilson,L., Kellie,S., Findell,P. and Watson,S.P.
Journal Blood 88 (2), 522-530 (1996)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.