• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor protein p63 (TP63), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003722 Homo sapiens tumor protein p63 (TP63), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_003722.4, 169234655
Length 4927 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens tumor protein p63 (TP63), transcript variant 1, mRNA.
Product tumor protein 63 isoform 1
Comment

Summary: This gene encodes a member of the p53 family of transcription factors. An animal model, p63 -/- mice, has been useful in defining the role this protein plays in the development and maintenance of stratified epithelial tissues. p63 -/- mice have several developmental defects which include the lack of limbs and other tissues, such as teeth and mammary glands, which develop as a result of interactions between mesenchyme and epithelium. Mutations in this gene are associated with ectodermal dysplasia, and cleft lip/palate syndrome 3 (EEC3); split-hand/foot malformation 4 (SHFM4); ankyloblepharon-ectodermal defects-cleft lip/palate; ADULT syndrome (acro-dermato-ungual-lacrimal-tooth); limb-mammary syndrome; Rap-Hodgkin syndrome (RHS); and orofacial cleft 8. Both alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different proteins. Many transcripts encoding different proteins have been reported but the biological validity and the full-length nature of these variants have not been determined. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) is the longest transcript and encodes the longest protein (isoform 1, also known as TAp63alpha, KET and p51B).

RefSeq NP_003713.3
CDS 90..2132
Misc Feature(1)66..68
Misc Feature(2)90..410
Misc Feature(3)90..410
Misc Feature(4)618..1163
Misc Feature(5)order(819..821,828..830,1011..1013,1023..1025)
Misc Feature(6)order(822..830,834..836)
Misc Feature(7)order(1014..1016,1020..1022,1041..1043,1116..1118,
Misc Feature(8)1143..1253
Misc Feature(9)1269..1418
Misc Feature(10)1278..1385
Misc Feature(11)1452..>1691
Misc Feature(12)1710..1907
Misc Feature(13)1716..1910
Misc Feature(14)1917..2129
Exon (1)1..151
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (2)152..280
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (3)281..413
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (4)414..668
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (5)669..855
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (6)856..971
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (7)972..1081
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (8)1082..1218
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (9)1219..1301
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (10)1302..1438
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (11)1439..1596
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (12)1597..1741
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (13)1742..1835
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Exon (14)1836..4909
Gene:TP63
Gene Synonym:AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Translation MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWD FLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSM DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR KQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQ LINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPP PPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG ILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWND FNFDMDARRNKQQRIKEEGE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
4+dbSNP:
4+a, gdbSNP:147353819
30+a, gdbSNP:367604538
32+a, tdbSNP:28673064
75+a, gdbSNP:200935681
108+c, tdbSNP:376627647
138+c, gdbSNP:200000559
156+dbSNP:
156+a, gdbSNP:144315591
173+g, tdbSNP:370716448
198+c, tdbSNP:147340040
206+c, tdbSNP:139505005
266+a, gdbSNP:151051217
287+dbSNP:
287+a, cdbSNP:142452541
293+a, gdbSNP:376192818
299+c, gdbSNP:201631366
344+a, gdbSNP:368463552
349+a, cdbSNP:71308973
375+a, gdbSNP:372543100
378+c, tdbSNP:121908848
392+a, gdbSNP:186864205
425+dbSNP:
425+a, gdbSNP:267599728
450+a, gdbSNP:111466227
455+a, gdbSNP:201774402
468+a, gdbSNP:375508394
475+c, tdbSNP:193287780
476+a, gdbSNP:151335217
488+c, tdbSNP:145730343
491+c, tdbSNP:201239102
521+a, gdbSNP:200459305
533+c, gdbSNP:150028891
585+c, tdbSNP:267599729
587+c, tdbSNP:146612442
593+c, tdbSNP:141278696
607+a, gdbSNP:113993965
608+c, gdbSNP:369833293
610+c, tdbSNP:201188464
647+c, tdbSNP:200355416
656+a, gdbSNP:373262255
763+dbSNP:
763+c, tdbSNP:374833411
766+a, gdbSNP:193921145
767+c, tdbSNP:61732782
777+c, gdbSNP:201466089
786+a, gdbSNP:121908838
788+a, gdbSNP:199727371
800+c, tdbSNP:199686014
802+c, tdbSNP:377757904
814+a, gdbSNP:201617537
816+c, tdbSNP:121908835
817+a, gdbSNP:121908836
839+c, tdbSNP:371524635
886+dbSNP:
886+a, gdbSNP:121908849
898+a, cdbSNP:79939938
928+a, tdbSNP:190865056
948+c, tdbSNP:33979049
989+dbSNP:
989+a, gdbSNP:372807713
complement(1001)-g, adbSNP:34119860
1042+a, gdbSNP:121908840
1044+c, tdbSNP:121908839
1098+dbSNP:
1098+c, gdbSNP:113993966
1099+a, gdbSNP:113993967
1117+a, gdbSNP:121908841
1122+c, tdbSNP:121908837
1133+a, gdbSNP:370101210
1141+a, gdbSNP:121908844
1143+a, gdbSNP:121908847
1151+a, gdbSNP:34841666
1172+a, gdbSNP:148937466
1183+c, tdbSNP:147148566
1191+a, gdbSNP:201706554
1199+c, tdbSNP:375593834
1210+c, tdbSNP:199807776
1216+a, gdbSNP:143591434
1219+dbSNP:
1219+c, tdbSNP:148052765
1250+a, gdbSNP:140374868
1331+dbSNP:
1331+a, gdbSNP:188455234
1403+a, gdbSNP:373897470
1410+c, tdbSNP:200973739
1456+dbSNP:
1456+c, tdbSNP:201479097
1457+a, gdbSNP:200558415
1463+a, gdbSNP:141794685
1474+a, gdbSNP:147181964
1478+a, cdbSNP:200802571
1489+a, gdbSNP:369453583
1502+c, tdbSNP:139407263
1554+a, gdbSNP:138832017
1569+a, gdbSNP:200203171
1572+a, gdbSNP:373849345
1586+g, tdbSNP:267599730
1602+dbSNP:
1602+a, gdbSNP:183154960
1619+g, tdbSNP:200578530
1620+a, cdbSNP:148076109
1664+c, tdbSNP:147389337
1670+c, tdbSNP:61752082
1676+c, tdbSNP:141847552
1679+c, tdbSNP:373284695
1685+a, gdbSNP:376238543
1715+a, gdbSNP:370637253
1735+c, tdbSNP:121908845
1748+dbSNP:
1748+a, tdbSNP:121908842
1764+c, tdbSNP:200463179
1769+a, gdbSNP:149465507
1770+g, tdbSNP:121908843
1796+a, gdbSNP:202009057
1806+a, gdbSNP:143884625
1827+c, g, tdbSNP:121908846
1870+dbSNP:
1870+a, gdbSNP:368336834
1871+a, tdbSNP:377605517
1877+a, gdbSNP:148577576
1903+a, gdbSNP:142981128
1914+a, gdbSNP:142762485
1916+a, gdbSNP:147538847
1935+, cdbSNP:113993964
1966+g, tdbSNP:372318389
1996+a, cdbSNP:376926686
2037+a, gdbSNP:140149400
2044..2045+, tdbSNP:35067146
2094+c, tdbSNP:143676789
2095+a, gdbSNP:369266838
2110+a, g, tdbSNP:34713855
2123+a, gdbSNP:140508531
2148+c, gdbSNP:201978861
2177+c, tdbSNP:34057105
complement(2209)-t, cdbSNP:140051057
2505+c, gdbSNP:188132962
2511+a, tdbSNP:192879052
2567+c, tdbSNP:78233713
complement(2603)-t, adbSNP:144018872
2673+a, gdbSNP:73199799
2759+c, tdbSNP:184452906
2770+c, gdbSNP:6444406
2986+a, gdbSNP:187751631
3029+a, gdbSNP:35263259
3109+a, tdbSNP:192558999
3305+c, tdbSNP:184547631
3393+g, tdbSNP:201329652
3475+c, tdbSNP:35659283
3518+c, tdbSNP:35785527
3558+c, tdbSNP:36099321
3569+c, gdbSNP:370056499
3604+a, gdbSNP:375551286
3653+c, tdbSNP:181693641
3683+a, gdbSNP:373145775
3732+c, gdbSNP:35896507
3752+c, tdbSNP:34328757
3887+c, gdbSNP:185247541
3910+c, tdbSNP:189729625
3927+, tdbSNP:370280085
3960+c, tdbSNP:149875270
3975..3976+, adbSNP:146332971
4045+a, gdbSNP:181220329
4057+c, gdbSNP:144916141
4075+c, tdbSNP:116568110
4079+, tdbSNP:140654135
4113+a, gdbSNP:186045329
4134+g, tdbSNP:35969817
4148+a, gdbSNP:115660354
4155+c, tdbSNP:189721510
4255+c, tdbSNP:36064124
4271+a, gdbSNP:35356690
4282+a, gdbSNP:181958566
4348+a, gdbSNP:35861864
4364..4365+, gdbSNP:35796357
4416+c, tdbSNP:146760848
4450+a, gdbSNP:199834330
4477+c, g, tdbSNP:35592567
4609+g, tdbSNP:186295449
4670+, tdbSNP:201395656
4757+a, tdbSNP:35694511
4768+, adbSNP:5855278
complement(4818)-t, cdbSNP:151060923
Gene SymbolTP63
Gene SynonymAIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Chromosome3
Locus Map3q28
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001114980 Homo sapiens tumor protein p63 (TP63), transcript variant 4, mRNA. On-demand $849.00 20
NM_001114982 Homo sapiens tumor protein p63 (TP63), transcript variant 6, mRNA. On-demand $549.00 14
NM_003722 Homo sapiens tumor protein p63 (TP63), transcript variant 1, mRNA. On-demand $849.00 20
NM_001114981 Homo sapiens tumor protein p63 (TP63), transcript variant 5, mRNA. On-demand $699.00 18
NM_001114979 Homo sapiens tumor protein p63 (TP63), transcript variant 3, mRNA. On-demand $699.00 18
NM_001114978 Homo sapiens tumor protein p63 (TP63), transcript variant 2, mRNA. On-demand $699.00 18
XM_005247843 PREDICTED: Homo sapiens tumor protein p63 (TP63), transcript variant X1, mRNA. On-demand $849.00 20
XM_005247844 PREDICTED: Homo sapiens tumor protein p63 (TP63), transcript variant X2, mRNA. On-demand $849.00 20
XM_005247846 PREDICTED: Homo sapiens tumor protein p63 (TP63), transcript variant X4, mRNA. On-demand $699.00 18
Title p53/TAp63 and AKT regulate mammalian target of rapamycin complex 1 (mTORC1) signaling through two independent parallel pathways in the presence of DNA damage .
Author Cam M, Bid HK, Xiao L, Zambetti GP, Houghton PJ and Cam H.
Journal J. Biol. Chem. 289 (7), 4083-4094 (2014)
Title A genetic variant in p63 (rs17506395) is associated with breast cancer susceptibility and prognosis .
Author Zhang N, Huo Q, Wang X, Chen X, Long L, Guan X, Jiang L, Ma T, Hu W and Yang Q.
Journal Gene 535 (2), 170-176 (2014)
Title Induced multipotency in adult keratinocytes through down-regulation of DeltaNp63 or DGCR8 .
Author Chakravarti D, Su X, Cho MS, Bui NH, Coarfa C, Venkatanarayan A, Benham AL, Flores Gonzalez RE, Alana J, Xiao W, Leung ML, Vin H, Chan IL, Aquino A, Muller N, Wang H, Cooney AJ, Parker-Thornburg J, Tsai KY, Gunaratne PH and Flores ER.
Journal Proc. Natl. Acad. Sci. U.S.A. 111 (5), E572-E581 (2014)
Title Use of p40 and p63 immunohistochemistry and human papillomavirus testing as ancillary tools for the recognition of head and neck sarcomatoid carcinoma and its distinction from benign and malignant mesenchymal processes .
Author Bishop JA, Montgomery EA and Westra WH.
Journal Am. J. Surg. Pathol. 38 (2), 257-264 (2014)
Title p53 and TAp63 promote keratinocyte proliferation and differentiation in breeding tubercles of the zebrafish .
Author Fischer B, Metzger M, Richardson R, Knyphausen P, Ramezani T, Franzen R, Schmelzer E, Bloch W, Carney TJ and Hammerschmidt M.
Journal PLoS Genet. 10 (1), E1004048 (2014)
Title A new human p53 homologue .
Author Trink,B., Okami,K., Wu,L., Sriuranpong,V., Jen,J. and Sidransky,D.
Journal Nat. Med. 4 (7), 747-748 (1998)
Title Non-p53 p53RE binding protein, a human transcription factor functionally analogous to P53 .
Author Zeng X, Levine AJ and Lu H.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (12), 6681-6686 (1998)
Title p53CP, a putative p53 competing protein that specifically binds to the consensus p53 DNA binding sites: a third member of the p53 family? .
Author Bian J and Sun Y.
Journal Proc. Natl. Acad. Sci. U.S.A. 94 (26), 14753-14758 (1997)
Title Characterization of Grb2-binding proteins in human platelets activated by Fc gamma RIIA cross-linking .
Author Robinson A, Gibbins J, Rodriguez-Linares B, Finan PM, Wilson L, Kellie S, Findell P and Watson SP.
Journal Blood 88 (2), 522-530 (1996)
Title Ankyloblepharon-Ectodermal Defects-Cleft Lip/Palate Syndrome .
Author Sutton,V.R., Bree,A.F. and van Bokhoven,H.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.