• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 11 (ABCB11), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003742 Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 11 (ABCB11), mRNA. GenEZ ORF Cloning In-stock $1198.00 $1149.00 16

*Business Day

Related Services

RefSeq Version NM_003742.2, 21536377
Length 4775 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 11 (ABCB11), mRNA.
Product bile salt export pump
Comment

Summary: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is the major canalicular bile salt export pump in man. Mutations in this gene cause a form of progressive familial intrahepatic cholestases which are a group of inherited disorders with severe cholestatic liver disease from early infancy. [provided by RefSeq, Jul 2008].

RefSeq NP_003733.2
CDS 127..4092
Misc Feature(1)7..9
Misc Feature(2)7..9
Misc Feature(3)187..4068
Misc Feature(4)187..4068
Misc Feature(5)313..375
Misc Feature(6)523..1230
Misc Feature(7)568..630
Misc Feature(8)772..834
Misc Feature(9)847..909
Misc Feature(10)1084..1146
Misc Feature(11)1186..1248
Misc Feature(12)1384..2097
Misc Feature(13)1489..1512
Misc Feature(14)order(1498..1503,1507..1515,1633..1635,1873..1878,
Misc Feature(15)1624..1635
Misc Feature(16)1801..1830
Misc Feature(17)1861..1878
Misc Feature(18)1885..1896
Misc Feature(19)1957..1977
Misc Feature(20)2077..2142
Misc Feature(21)2392..2454
Misc Feature(22)2410..3219
Misc Feature(23)2509..2571
Misc Feature(24)2734..2796
Misc Feature(25)2797..2859
Misc Feature(26)3064..3126
Misc Feature(27)3160..3222
Misc Feature(28)3358..4077
Misc Feature(29)3463..3486
Misc Feature(30)order(3472..3477,3481..3489,3607..3609,3853..3858,
Misc Feature(31)3598..3609
Misc Feature(32)3781..3810
Misc Feature(33)3841..3858
Misc Feature(34)3865..3876
Misc Feature(35)3937..3957
Exon (1)1..99
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (2)100..202
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (3)203..224
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (4)225..276
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (5)277..515
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (6)516..603
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (7)604..737
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (8)738..909
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (9)910..1034
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (10)1035..1209
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (11)1210..1323
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (12)1324..1434
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (13)1435..1560
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (14)1561..1764
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (15)1765..1935
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (16)1936..2137
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (17)2138..2201
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (18)2202..2304
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (19)2305..2469
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (20)2470..2574
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (21)2575..2736
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (22)2737..2940
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (23)2941..3182
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (24)3183..3339
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (25)3340..3537
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (26)3538..3744
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (27)3745..3891
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (28)3892..4775
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Translation MSDSVILRSIKKFGEENDGFESDKSYNNDKKSRLQDEKKGDGVRVGFFQLFRFSSSTDIW LMFVGSLCAFLHGIAQPGVLLIFGTMTDVFIDYDVELQELQIPGKACVNNTIVWTNSSLN QNMTNGTRCGLLNIESEMIKFASYYAGIAVAVLITGYIQICFWVIAAARQIQKMRKFYFR RIMRMEIGWFDCNSVGELNTRFSDDINKINDAIADQMALFIQRMTSTICGFLLGFFRGWK LTLVIISVSPLIGIGAATIGLSVSKFTDYELKAYAKAGVVADEVISSMRTVAAFGGEKRE VERYEKNLVFAQRWGIRKGIVMGFFTGFVWCLIFLCYALAFWYGSTLVLDEGEYTPGTLV QIFLSVIVGALNLGNASPCLEAFATGRAAATSIFETIDRKPIIDCMSEDGYKLDRIKGEI EFHNVTFHYPSRPEVKILNDLNMVIKPGEMTALVGPSGAGKSTALQLIQRFYDPCEGMVT VDGHDIRSLNIQWLRDQIGIVEQEPVLFSTTIAENIRYGREDATMEDIVQAAKEANAYNF IMDLPQQFDTLVGEGGGQMSGGQKQRVAIARALIRNPKILLLDMATSALDNESEAMVQEV LSKIQHGHTIISVAHRLSTVRAADTIIGFEHGTAVERGTHEELLERKGVYFTLVTLQSQG NQALNEEDIKDATEDDMLARTFSRGSYQDSLRASIRQRSKSQLSYLVHEPPLAVVDHKST YEEDRKDKDIPVQEEVEPAPVRRILKFSAPEWPYMLVGSVGAAVNGTVTPLYAFLFSQIL GTFSIPDKEEQRSQINGVCLLFVAMGCVSLFTQFLQGYAFAKSGELLTKRLRKFGFRAML GQDIAWFDDLRNSPGALTTRLATDASQVQGAAGSQIGMIVNSFTNVTVAMIIAFSFSWKL SLVILCFFPFLALSGATQTRMLTGFASRDKQALEMVGQITNEALSNIRTVAGIGKERRFI EALETELEKPFKTAIQKANIYGFCFAFAQCIMFIANSASYRYGGYLISNEGLHFSYVFRV ISAVVLSATALGRAFSYTPSYAKAKISAARFFQLLDRQPPISVYNTAGEKWDNFQGKIDF VDCKFTYPSRPDSQVLNGLSVSISPGQTLAFVGSSGCGKSTSIQLLERFYDPDQGKVMID GHDSKKVNVQFLRSNIGIVSQEPVLFACSIMDNIKYGDNTKEIPMERVIAAAKQAQLHDF VMSLPEKYETNVGSQGSQLSRGEKQRIAIARAIVRDPKILLLDEATSALDTESEKTVQVA LDKAREGRTCIVIAHRLSTIQNADIIAVMAQGVVIEKGTHEELMAQKGAYYKLVTTGSPI S
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(59)-g, adbSNP:56766143
complement(164)-g, adbSNP:201203913
complement(223)-dbSNP:
complement(223)-t, gdbSNP:191280849
complement(234)-dbSNP:
complement(234)-t, cdbSNP:3815675
complement(252)-g, adbSNP:138800291
complement(253)-t, cdbSNP:183406496
complement(282)-dbSNP:
complement(282)-t, cdbSNP:140587295
complement(293)-t, cdbSNP:11568361
complement(300)-t, cdbSNP:11568362
complement(396)-t, cdbSNP:4148777
complement(409)-t, cdbSNP:201735739
complement(509)-t, cdbSNP:181533618
complement(516)-dbSNP:
complement(516)-, cdbSNP:72551308
complement(528)-t, cdbSNP:11568377
complement(534)-g, adbSNP:183214630
complement(603)-t, cdbSNP:191042013
complement(625)-dbSNP:
complement(625)-t, cdbSNP:139641883
complement(632)-t, cdbSNP:200870815
complement(683)-t, cdbSNP:72551307
complement(711)-g, cdbSNP:11568365
complement(742)-dbSNP:
complement(742)-g, adbSNP:11568357
complement(793)-g, adbSNP:199841445
complement(822)-t, gdbSNP:11568358
complement(839)-c, adbSNP:72551306
complement(864)-g, adbSNP:201248392
complement(933)-dbSNP:
complement(933)-t, cdbSNP:2287616
complement(977)-g, adbSNP:200739891
complement(1009)-c, adbSNP:76133714
complement(1016)-g, adbSNP:11568372
complement(1022)-g, adbSNP:2287617
complement(1057)-c, adbSNP:200509511
complement(1083)-t, cdbSNP:7563233
complement(1132)-t, adbSNP:72551305
complement(1181)-t, cdbSNP:201351924
complement(1311)-dbSNP:
complement(1311)-t, cdbSNP:57509552
complement(1374)-dbSNP:
complement(1374)-t, g, adbSNP:183390670
complement(1380)-g, adbSNP:140138979
complement(1389)-t, cdbSNP:202165855
complement(1394)-t, cdbSNP:147522210
complement(1407)-t, cdbSNP:11568360
complement(1421)-g, cdbSNP:121908935
complement(1457)-dbSNP:
complement(1457)-t, g, c, adbSNP:2287622
complement(1502)-g, adbSNP:190094490
complement(1522)-t, gdbSNP:200148505
complement(1530)-t, adbSNP:34200464
complement(1571)-dbSNP:
complement(1571)-t, cdbSNP:72549402
complement(1586)-t, cdbSNP:188824058
complement(1731)-g, adbSNP:144848376
complement(1754)-t, gdbSNP:200687717
complement(1762)-t, gdbSNP:111482608
complement(1797)-dbSNP:
complement(1797)-t, cdbSNP:11568368
complement(1800)-g, cdbSNP:11568369
complement(1849)-g, adbSNP:72549401
complement(1850)-t, cdbSNP:200667815
complement(1898)-g, adbSNP:11568367
complement(1900)-g, cdbSNP:11568370
complement(1915)-t, cdbSNP:72886795
complement(1917)-t, gdbSNP:11568371
complement(1954)-dbSNP:
complement(1954)-t, cdbSNP:200185768
complement(1968)-g, adbSNP:201589744
complement(2033)-t, adbSNP:199671371
complement(2091)-c, adbSNP:200156612
complement(2155)-dbSNP:
complement(2155)-g, adbSNP:11568364
complement(2162)-g, adbSNP:200912109
complement(2213)-dbSNP:
complement(2213)-t, cdbSNP:141862495
complement(2219)-t, cdbSNP:138642043
complement(2227)-g, adbSNP:150572999
complement(2251)-t, cdbSNP:201800225
complement(2260)-g, adbSNP:191649793
complement(2276)-t, cdbSNP:201255929
complement(2317)-dbSNP:
complement(2317)-g, adbSNP:201240844
complement(2421)-g, adbSNP:202158121
complement(2424)-t, cdbSNP:200087122
complement(2538)-dbSNP:
complement(2538)-g, adbSNP:11568373
complement(2720)-dbSNP:
complement(2720)-g, adbSNP:118109635
complement(2735)-c, adbSNP:201068438
complement(2746)-dbSNP:
complement(2746)-g, adbSNP:184334834
complement(2754)-g, adbSNP:200127070
complement(2894)-g, adbSNP:199514789
complement(2902)-g, cdbSNP:72549400
complement(2909)-t, cdbSNP:200488448
complement(2937)-t, adbSNP:192375476
complement(2943)-dbSNP:
complement(2943)-c, adbSNP:190613050
complement(2960)-t, cdbSNP:200857579
complement(3000..3001)-, ccccdbSNP:138486918
complement(3001)-c, adbSNP:186967666
complement(3002)-c, adbSNP:182129818
complement(3012)-t, cdbSNP:201087979
complement(3019)-t, adbSNP:187663132
complement(3033)-t, cdbSNP:201881755
complement(3038)-t, adbSNP:193101681
complement(3039)-t, gdbSNP:192999247
complement(3053)-t, cdbSNP:199940188
complement(3069)-g, adbSNP:145720664
complement(3070)-t, cdbSNP:72549399
complement(3111)-t, cdbSNP:113923887
complement(3138)-g, adbSNP:41265143
complement(3144)-t, adbSNP:188946054
complement(3151)-t, gdbSNP:183499641
complement(3210)-dbSNP:
complement(3210)-g, adbSNP:497692
complement(3258)-g, adbSNP:199974713
complement(3274)-g, adbSNP:72549398
complement(3295)-g, adbSNP:72549397
complement(3296)-t, cdbSNP:200174512
complement(3384)-dbSNP:
complement(3384)-g, adbSNP:11568359
complement(3394)-g, adbSNP:72549396
complement(3456)-t, cdbSNP:113099601
complement(3552)-dbSNP:
complement(3552)-c, adbSNP:200735761
complement(3561)-g, adbSNP:11568366
complement(3583)-g, adbSNP:72549395
complement(3632)-t, cdbSNP:201481590
complement(3634)-t, adbSNP:199762750
complement(3638)-g, adbSNP:183621659
complement(3650)-t, gdbSNP:200709879
complement(3674)-g, adbSNP:143484849
complement(3682)-g, adbSNP:1521808
complement(3795)-g, cdbSNP:199649780
complement(3929)-dbSNP:
complement(3929)-t, cdbSNP:72549394
complement(3938)-t, adbSNP:201296827
complement(3955)-t, adbSNP:200395431
complement(4088)-t, cdbSNP:201693189
complement(4157)-, tdbSNP:5836212
complement(4170)-t, cdbSNP:3770571
complement(4291)-t, cdbSNP:13425780
complement(4328)-t, g, c, adbSNP:473351
complement(4373)-c, adbSNP:3732038
complement(4460)-g, adbSNP:495714
complement(4490)-g, adbSNP:147741834
complement(4491)-t, cdbSNP:73014701
complement(4508)-t, cdbSNP:77005833
complement(4512)-g, adbSNP:496550
complement(4532)-t, cdbSNP:79130028
Gene SymbolABCB11
Gene SynonymABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Chromosome2
Locus Map2q24
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003742 Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 11 (ABCB11), mRNA. In-stock $1198.00 $1149.00 16
Title A C-terminal tyrosine-based motif in the bile salt export pump directs clathrin-dependent endocytosis .
Author Lam,P., Xu,S., Soroka,C.J. and Boyer,J.L.
Journal Hepatology 55 (6), 1901-1911 (2012)
Title Hepatobiliary transporter expression and post-operative jaundice in patients undergoing partial hepatectomy .
Author Bernhardt,G.A., Zollner,G., Cerwenka,H., Kornprat,P., Fickert,P., Bacher,H., Werkgartner,G., Muller,G., Zatloukal,K., Mischinger,H.J. and Trauner,M.
Journal Liver Int. 32 (1), 119-127 (2012)
Title A frequent variant in the human bile salt export pump gene ABCB11 is associated with hepatitis C virus infection, but not liver stiffness in a German population .
Author Mullenbach,R., Weber,S.N., Krawczyk,M., Zimmer,V., Sarrazin,C., Lammert,F. and Grunhage,F.
Journal BMC Gastroenterol 12, 63 (2012)
Title Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma .
Author Chambers,J.C., Zhang,W., Sehmi,J., Li,X., Wass,M.N., Van der Harst,P., Holm,H., Sanna,S., Kavousi,M., Baumeister,S.E., Coin,L.J., Deng,G., Gieger,C., Heard-Costa,N.L., Hottenga,J.J., Kuhnel,B., Kumar,V., Lagou,V., Liang,L., Luan,J., Vidal,P.M., Mateo Leach,I., O'Reilly,P.F., Peden,J.F., Rahmioglu,N., Soininen,P., Speliotes,E.K., Yuan,X., Thorleifsson,G., Alizadeh,B.Z., Atwood,L.D., Borecki,I.B., Brown,M.J., Charoen,P., Cucca,F., Das,D., de Geus,E.J., Dixon,A.L., Doring,A., Ehret,G., Eyjolfsson,G.I., Farrall,M., Forouhi,N.G., Friedrich,N., Goessling,W., Gudbjartsson,D.F., Harris,T.B., Hartikainen,A.L., Heath,S., Hirschfield,G.M., Hofman,A., Homuth,G., Hypponen,E., Janssen,H.L., Johnson,T., Kangas,A.J., Kema,I.P., Kuhn,J.P., Lai,S., Lathrop,M., Lerch,M.M., Li,Y., Liang,T.J., Lin,J.P., Loos,R.J., Martin,N.G., Moffatt,M.F., Montgomery,G.W., Munroe,P.B., Musunuru,K., Nakamura,Y., O'Donnell,C.J., Olafsson,I., Penninx,B.W., Pouta,A., Prins,B.P., Prokopenko,I., Puls,R., Ruokonen,A., Savolainen,M.J., Schlessinger,D., Schouten,J.N., Seedorf,U., Sen-Chowdhry,S., Siminovitch,K.A., Smit,J.H., Spector,T.D., Tan,W., Teslovich,T.M., Tukiainen,T., Uitterlinden,A.G., Van der Klauw,M.M., Vasan,R.S., Wallace,C., Wallaschofski,H., Wichmann,H.E., Willemsen,G., Wurtz,P., Xu,C., Yerges-Armstrong,L.M., Abecasis,G.R., Ahmadi,K.R., Boomsma,D.I., Caulfield,M., Cookson,W.O., van Duijn,C.M., Froguel,P., Matsuda,K., McCarthy,M.I., Meisinger,C., Mooser,V., Pietilainen,K.H., Schumann,G., Snieder,H., Sternberg,M.J., Stolk,R.P., Thomas,H.C., Thorsteinsdottir,U., Uda,M., Waeber,G., Wareham,N.J., Waterworth,D.M., Watkins,H., Whitfield,J.B., Witteman,J.C., Wolffenbuttel,B.H., Fox,C.S., Ala-Korpela,M., Stefansson,K., Vollenweider,P., Volzke,H., Schadt,E.E., Scott,J., Jarvelin,M.R., Elliott,P. and Kooner,J.S.
Journal Nat. Genet. 43 (11), 1131-1138 (2011)
Title Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits .
Author Kim,Y.J., Go,M.J., Hu,C., Hong,C.B., Kim,Y.K., Lee,J.Y., Hwang,J.Y., Oh,J.H., Kim,D.J., Kim,N.H., Kim,S., Hong,E.J., Kim,J.H., Min,H., Kim,Y., Zhang,R., Jia,W., Okada,Y., Takahashi,A., Kubo,M., Tanaka,T., Kamatani,N., Matsuda,K., Park,T., Oh,B., Kimm,K., Kang,D., Shin,C., Cho,N.H., Kim,H.L., Han,B.G., Lee,J.Y. and Cho,Y.S.
Journal Nat. Genet. 43 (10), 990-995 (2011)
Title The multidrug resistance P-glycoprotein. Oligomeric state and intramolecular interactions .
Author Taylor,J.C., Horvath,A.R., Higgins,C.F. and Begley,G.S.
Journal J. Biol. Chem. 276 (39), 36075-36078 (2001)
Title Targeted inactivation of sister of P-glycoprotein gene (spgp) in mice results in nonprogressive but persistent intrahepatic cholestasis .
Author Wang,R., Salem,M., Yousef,I.M., Tuchweber,B., Lam,P., Childs,S.J., Helgason,C.D., Ackerley,C., Phillips,M.J. and Ling,V.
Journal Proc. Natl. Acad. Sci. U.S.A. 98 (4), 2011-2016 (2001)
Title Hepatocanalicular bile salt export pump deficiency in patients with progressive familial intrahepatic cholestasis .
Author Jansen,P.L., Strautnieks,S.S., Jacquemin,E., Hadchouel,M., Sokal,E.M., Hooiveld,G.J., Koning,J.H., De Jager-Krikken,A., Kuipers,F., Stellaard,F., Bijleveld,C.M., Gouw,A., Van Goor,H., Thompson,R.J. and Muller,M.
Journal Gastroenterology 117 (6), 1370-1379 (1999)
Title A gene encoding a liver-specific ABC transporter is mutated in progressive familial intrahepatic cholestasis .
Author Strautnieks,S.S., Bull,L.N., Knisely,A.S., Kocoshis,S.A., Dahl,N., Arnell,H., Sokal,E., Dahan,K., Childs,S., Ling,V., Tanner,M.S., Kagalwalla,A.F., Nemeth,A., Pawlowska,J., Baker,A., Mieli-Vergani,G., Freimer,N.B., Gardiner,R.M. and Thompson,R.J.
Journal Nat. Genet. 20 (3), 233-238 (1998)
Title The sister of P-glycoprotein represents the canalicular bile salt export pump of mammalian liver .
Author Gerloff,T., Stieger,B., Hagenbuch,B., Madon,J., Landmann,L., Roth,J., Hofmann,A.F. and Meier,P.J.
Journal J. Biol. Chem. 273 (16), 10046-10050 (1998)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.