• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 11 (ABCB11), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003742 Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 11 (ABCB11), mRNA. GenEZ ORF Cloning In-stock $1198.00 $1149.00 16

*Business Day

Related Services

RefSeq Version NM_003742.2, 21536377
Length 4775 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 11 (ABCB11), mRNA.
Product bile salt export pump
Comment

Summary: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is the major canalicular bile salt export pump in man. Mutations in this gene cause a form of progressive familial intrahepatic cholestases which are a group of inherited disorders with severe cholestatic liver disease from early infancy. [provided by RefSeq, Jul 2008].

RefSeq NP_003733.2
CDS 127..4092
Misc Feature(1)7..9
Misc Feature(2)7..9
Misc Feature(3)187..4068
Misc Feature(4)187..4068
Misc Feature(5)313..375
Misc Feature(6)523..1245
Misc Feature(7)568..630
Misc Feature(8)772..834
Misc Feature(9)847..909
Misc Feature(10)1084..1146
Misc Feature(11)1186..1248
Misc Feature(12)1384..2097
Misc Feature(13)1489..1512
Misc Feature(14)order(1498..1503,1507..1515,1633..1635,1873..1878,
Misc Feature(15)1624..1635
Misc Feature(16)1801..1830
Misc Feature(17)1861..1878
Misc Feature(18)1885..1896
Misc Feature(19)1957..1977
Misc Feature(20)2077..2142
Misc Feature(21)2392..2454
Misc Feature(22)2410..3219
Misc Feature(23)2509..2571
Misc Feature(24)2734..2796
Misc Feature(25)2797..2859
Misc Feature(26)3064..3126
Misc Feature(27)3160..3222
Misc Feature(28)3358..4077
Misc Feature(29)3463..3486
Misc Feature(30)order(3472..3477,3481..3489,3607..3609,3853..3858,
Misc Feature(31)3598..3609
Misc Feature(32)3781..3810
Misc Feature(33)3841..3858
Misc Feature(34)3865..3876
Misc Feature(35)3937..3957
Exon (1)1..99
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (2)100..202
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (3)203..224
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (4)225..276
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (5)277..515
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (6)516..603
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (7)604..737
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (8)738..909
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (9)910..1034
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (10)1035..1209
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (11)1210..1323
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (12)1324..1434
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (13)1435..1560
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (14)1561..1764
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (15)1765..1935
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (16)1936..2137
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (17)2138..2201
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (18)2202..2304
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (19)2305..2469
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (20)2470..2574
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (21)2575..2736
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (22)2737..2940
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (23)2941..3182
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (24)3183..3339
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (25)3340..3537
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (26)3538..3744
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (27)3745..3891
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Exon (28)3892..4775
Gene:ABCB11
Gene Synonym:ABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Translation MSDSVILRSIKKFGEENDGFESDKSYNNDKKSRLQDEKKGDGVRVGFFQLFRFSSSTDIW LMFVGSLCAFLHGIAQPGVLLIFGTMTDVFIDYDVELQELQIPGKACVNNTIVWTNSSLN QNMTNGTRCGLLNIESEMIKFASYYAGIAVAVLITGYIQICFWVIAAARQIQKMRKFYFR RIMRMEIGWFDCNSVGELNTRFSDDINKINDAIADQMALFIQRMTSTICGFLLGFFRGWK LTLVIISVSPLIGIGAATIGLSVSKFTDYELKAYAKAGVVADEVISSMRTVAAFGGEKRE VERYEKNLVFAQRWGIRKGIVMGFFTGFVWCLIFLCYALAFWYGSTLVLDEGEYTPGTLV QIFLSVIVGALNLGNASPCLEAFATGRAAATSIFETIDRKPIIDCMSEDGYKLDRIKGEI EFHNVTFHYPSRPEVKILNDLNMVIKPGEMTALVGPSGAGKSTALQLIQRFYDPCEGMVT VDGHDIRSLNIQWLRDQIGIVEQEPVLFSTTIAENIRYGREDATMEDIVQAAKEANAYNF IMDLPQQFDTLVGEGGGQMSGGQKQRVAIARALIRNPKILLLDMATSALDNESEAMVQEV LSKIQHGHTIISVAHRLSTVRAADTIIGFEHGTAVERGTHEELLERKGVYFTLVTLQSQG NQALNEEDIKDATEDDMLARTFSRGSYQDSLRASIRQRSKSQLSYLVHEPPLAVVDHKST YEEDRKDKDIPVQEEVEPAPVRRILKFSAPEWPYMLVGSVGAAVNGTVTPLYAFLFSQIL GTFSIPDKEEQRSQINGVCLLFVAMGCVSLFTQFLQGYAFAKSGELLTKRLRKFGFRAML GQDIAWFDDLRNSPGALTTRLATDASQVQGAAGSQIGMIVNSFTNVTVAMIIAFSFSWKL SLVILCFFPFLALSGATQTRMLTGFASRDKQALEMVGQITNEALSNIRTVAGIGKERRFI EALETELEKPFKTAIQKANIYGFCFAFAQCIMFIANSASYRYGGYLISNEGLHFSYVFRV ISAVVLSATALGRAFSYTPSYAKAKISAARFFQLLDRQPPISVYNTAGEKWDNFQGKIDF VDCKFTYPSRPDSQVLNGLSVSISPGQTLAFVGSSGCGKSTSIQLLERFYDPDQGKVMID GHDSKKVNVQFLRSNIGIVSQEPVLFACSIMDNIKYGDNTKEIPMERVIAAAKQAQLHDF VMSLPEKYETNVGSQGSQLSRGEKQRIAIARAIVRDPKILLLDEATSALDTESEKTVQVA LDKAREGRTCIVIAHRLSTIQNADIIAVMAQGVVIEKGTHEELMAQKGAYYKLVTTGSPI S
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
59+a, gdbSNP:56766143
complement(149)-t, cdbSNP:368985605
complement(164)-g, adbSNP:201203913
complement(187)-g, cdbSNP:377170187
complement(202)-t, adbSNP:372790699
complement(223)-dbSNP:
complement(223)-t, gdbSNP:191280849
complement(228)-dbSNP:
complement(228)-t, cdbSNP:367732132
234+c, tdbSNP:3815675
complement(252)-g, adbSNP:138800291
complement(253)-t, cdbSNP:183406496
complement(282)-dbSNP:
complement(282)-t, cdbSNP:140587295
complement(292)-g, adbSNP:374370625
complement(293)-t, cdbSNP:11568361
complement(293)-g, adbSNP:386519427
complement(300)-t, cdbSNP:11568362
complement(300)-t, cdbSNP:386519428
complement(361)-t, cdbSNP:371965391
complement(396)-t, cdbSNP:386591488
396+c, tdbSNP:4148777
complement(405)-g, adbSNP:375137002
complement(409)-t, cdbSNP:201735739
complement(444)-t, cdbSNP:371672954
complement(487)-t, gdbSNP:367611268
complement(493)-t, adbSNP:373666118
complement(509)-t, cdbSNP:181533618
complement(528)-dbSNP:
complement(528)-t, cdbSNP:11568377
complement(534)-g, adbSNP:183214630
complement(554)-t, cdbSNP:377591610
complement(576)-g, adbSNP:376327318
complement(603)-t, cdbSNP:191042013
complement(625)-dbSNP:
complement(625)-t, cdbSNP:139641883
complement(632)-t, cdbSNP:200870815
complement(642)-t, cdbSNP:371303460
complement(681)-t, cdbSNP:367704601
complement(683)-t, cdbSNP:72551307
complement(711)-g, cdbSNP:11568365
complement(742)-dbSNP:
complement(742)-t, cdbSNP:386519426
complement(742)-g, adbSNP:11568357
complement(793)-g, adbSNP:199841445
complement(801)-g, cdbSNP:375436478
822+g, tdbSNP:11568358
complement(839)-c, adbSNP:72551306
complement(859)-t, cdbSNP:370060847
complement(864)-g, adbSNP:201248392
complement(928)-dbSNP:
complement(928)-c, adbSNP:377039594
933+c, tdbSNP:2287616
complement(933)-g, adbSNP:386563692
complement(936)-t, cdbSNP:369671177
complement(977)-g, adbSNP:200739891
complement(988)-t, cdbSNP:372861607
1009+a, cdbSNP:76133714
complement(1022)-t, cdbSNP:386563693
complement(1022)-g, adbSNP:2287617
complement(1024)-t, cdbSNP:267598994
complement(1056)-g, adbSNP:372382608
complement(1057)-t, c, adbSNP:200509511
complement(1063)-t, gdbSNP:375087680
complement(1064)-t, cdbSNP:372175341
complement(1076)-g, cdbSNP:368142114
complement(1078)-t, cdbSNP:374262721
complement(1083)-t, cdbSNP:7563233
complement(1083)-t, cdbSNP:386611458
complement(1132)-t, adbSNP:72551305
complement(1138)-c, adbSNP:376427140
complement(1139)-g, adbSNP:374535231
complement(1181)-t, cdbSNP:201351924
complement(1188)-g, adbSNP:376258647
complement(1218)-dbSNP:
complement(1218)-g, adbSNP:373048820
complement(1239)-t, cdbSNP:369132677
complement(1286)-t, cdbSNP:372784355
complement(1303)-t, cdbSNP:369484793
complement(1311)-t, cdbSNP:57509552
complement(1335)-dbSNP:
complement(1335)-t, adbSNP:374115690
complement(1370)-t, cdbSNP:371656014
complement(1374)-t, g, adbSNP:183390670
complement(1380)-g, adbSNP:140138979
complement(1389)-t, cdbSNP:202165855
complement(1394)-t, cdbSNP:147522210
complement(1397)-t, gdbSNP:371091982
complement(1407)-t, cdbSNP:11568360
1421+c, gdbSNP:121908935
complement(1434)-t, cdbSNP:375118696
1457+dbSNP:
1457+a, c, g, tdbSNP:2287622
complement(1457)-t, cdbSNP:386563695
complement(1502)-g, adbSNP:190094490
complement(1522)-t, gdbSNP:200148505
1530+a, tdbSNP:34200464
complement(1541)-t, cdbSNP:369860506
complement(1567)-dbSNP:
complement(1567)-t, cdbSNP:371742655
complement(1571)-t, cdbSNP:72549402
complement(1586)-t, cdbSNP:188824058
complement(1615)-g, adbSNP:267598993
complement(1656)-t, gdbSNP:374701109
complement(1731)-g, adbSNP:144848376
complement(1754)-t, gdbSNP:200687717
complement(1762)-t, gdbSNP:111482608
complement(1779)-dbSNP:
complement(1779)-g, adbSNP:374603354
complement(1790)-g, cdbSNP:370566153
1797+c, tdbSNP:11568368
1800+c, gdbSNP:11568369
complement(1818)-t, cdbSNP:377593886
complement(1849)-g, adbSNP:72549401
complement(1850)-t, cdbSNP:200667815
complement(1859)-t, cdbSNP:373193237
1898+a, gdbSNP:11568367
complement(1898)-t, cdbSNP:386519430
1900+c, gdbSNP:11568370
complement(1914)-g, cdbSNP:373443561
complement(1915)-t, cdbSNP:72886795
complement(1917)-t, gdbSNP:11568371
complement(1917)-c, adbSNP:386519431
complement(1954)-dbSNP:
complement(1954)-t, cdbSNP:200185768
complement(1968)-g, adbSNP:201589744
complement(1972)-g, adbSNP:369187042
complement(2033)-t, adbSNP:199671371
complement(2036)-t, cdbSNP:375039345
complement(2091)-c, adbSNP:200156612
complement(2113)-t, cdbSNP:371319925
complement(2116)-g, cdbSNP:367713824
complement(2155)-dbSNP:
complement(2155)-g, adbSNP:11568364
complement(2162)-g, adbSNP:200912109
complement(2212)-dbSNP:
complement(2212)-g, adbSNP:376216286
complement(2213)-t, cdbSNP:141862495
complement(2219)-t, cdbSNP:138642043
complement(2227)-g, adbSNP:150572999
complement(2251)-t, cdbSNP:201800225
complement(2260)-g, adbSNP:191649793
complement(2261)-g, adbSNP:372939910
complement(2276)-t, cdbSNP:201255929
complement(2312)-dbSNP:
complement(2312)-t, adbSNP:369030137
complement(2317)-g, adbSNP:201240844
complement(2319)-c, adbSNP:371893470
complement(2328)-t, gdbSNP:369865521
complement(2338)-g, adbSNP:376842756
complement(2354)-g, cdbSNP:372228971
complement(2389)-t, gdbSNP:368297188
complement(2421)-g, adbSNP:202158121
complement(2424)-t, cdbSNP:200087122
complement(2457)-g, adbSNP:375098674
complement(2532)-dbSNP:
complement(2532)-c, adbSNP:368092083
2538+a, gdbSNP:11568373
complement(2579)-dbSNP:
complement(2579)-t, adbSNP:374548469
complement(2621)-t, cdbSNP:376255350
complement(2641)-t, cdbSNP:372757355
complement(2646)-c, adbSNP:369231927
complement(2649)-t, cdbSNP:367874361
complement(2653)-g, cdbSNP:377240498
complement(2720)-g, adbSNP:118109635
complement(2735)-c, adbSNP:201068438
complement(2746)-dbSNP:
complement(2746)-g, adbSNP:184334834
complement(2754)-g, adbSNP:200127070
complement(2826)-g, cdbSNP:371263629
complement(2844)-g, adbSNP:367731325
complement(2883)-t, gdbSNP:374465656
complement(2894)-g, adbSNP:199514789
complement(2902)-g, cdbSNP:72549400
complement(2909)-t, cdbSNP:200488448
complement(2937)-t, adbSNP:192375476
complement(2943)-dbSNP:
complement(2943)-c, adbSNP:190613050
complement(2960)-t, cdbSNP:200857579
complement(3000..3001)-, ccccdbSNP:138486918
complement(3001)-c, adbSNP:186967666
complement(3002)-c, adbSNP:182129818
complement(3012)-t, cdbSNP:201087979
complement(3019)-t, adbSNP:187663132
complement(3033)-t, cdbSNP:201881755
complement(3038)-t, adbSNP:193101681
complement(3039)-t, gdbSNP:192999247
complement(3053)-t, cdbSNP:199940188
complement(3056)-t, cdbSNP:369859057
complement(3069)-g, adbSNP:145720664
complement(3070)-t, cdbSNP:72549399
complement(3111)-t, cdbSNP:113923887
complement(3117)-g, adbSNP:369798700
complement(3137)-c, adbSNP:375151067
complement(3138)-g, adbSNP:41265143
complement(3142)-g, adbSNP:372157024
complement(3144)-t, adbSNP:188946054
complement(3151)-t, gdbSNP:183499641
complement(3186)-dbSNP:
complement(3186)-t, cdbSNP:368622067
complement(3192)-g, adbSNP:374539264
3210+a, gdbSNP:497692
complement(3258)-g, adbSNP:199974713
complement(3274)-g, adbSNP:72549398
complement(3295)-g, adbSNP:72549397
complement(3296)-t, cdbSNP:200174512
complement(3317)-t, adbSNP:373885791
complement(3359)-dbSNP:
complement(3359)-g, adbSNP:373201488
complement(3384)-g, adbSNP:11568359
complement(3394)-g, adbSNP:72549396
complement(3402)-g, adbSNP:371859686
complement(3405)-t, cdbSNP:368393726
complement(3432)-c, adbSNP:377691925
complement(3436)-t, adbSNP:377222158
complement(3455)-t, gdbSNP:373956718
complement(3456)-t, cdbSNP:113099601
complement(3552)-dbSNP:
complement(3552)-c, adbSNP:200735761
3561+a, gdbSNP:11568366
complement(3561)-g, adbSNP:386519429
complement(3575)-t, cdbSNP:369313569
complement(3583)-g, adbSNP:72549395
complement(3587)-g, adbSNP:367730178
complement(3632)-t, cdbSNP:201481590
complement(3634)-t, adbSNP:199762750
complement(3638)-g, adbSNP:183621659
complement(3650)-t, gdbSNP:200709879
complement(3674)-g, adbSNP:143484849
complement(3682)-g, adbSNP:1521808
complement(3761)-dbSNP:
complement(3761)-g, adbSNP:375288223
complement(3795)-g, cdbSNP:199649780
complement(3832)-c, adbSNP:377426819
3893..3894+dbSNP:
3893..3894+, cdbSNP:387907317
complement(3901)-t, cdbSNP:377043039
complement(3929)-t, cdbSNP:72549394
complement(3938)-t, adbSNP:201296827
complement(3955)-t, adbSNP:200395431
complement(3968)-t, adbSNP:373615768
complement(3972)-g, adbSNP:369538863
complement(3974)-g, adbSNP:372886308
complement(4020)-t, cdbSNP:368858732
complement(4032)-t, cdbSNP:375782077
complement(4043)-t, cdbSNP:371501344
complement(4056)-g, adbSNP:370059309
complement(4080)-g, adbSNP:376013207
complement(4088)-t, cdbSNP:201693189
complement(4109)-g, adbSNP:372238963
complement(4170)-t, cdbSNP:3770571
complement(4243)-g, adbSNP:373284476
complement(4273)-g, adbSNP:369877779
complement(4291)-t, cdbSNP:13425780
complement(4328)-t, g, c, adbSNP:473351
complement(4328)-t, cdbSNP:386594973
complement(4373)-c, adbSNP:3732038
4460+a, gdbSNP:495714
complement(4460)-g, adbSNP:386596732
complement(4490)-g, adbSNP:147741834
complement(4491)-t, cdbSNP:73014701
complement(4508)-t, cdbSNP:77005833
complement(4512)-t, cdbSNP:386596809
complement(4512)-g, adbSNP:496550
complement(4532)-t, cdbSNP:79130028
Gene SymbolABCB11
Gene SynonymABC16; BRIC2; BSEP; PFIC-2; PFIC2; PGY4; SPGP
Chromosome2
Locus Map2q24
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003742 Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 11 (ABCB11), mRNA. In-stock $1198.00 $1149.00 16
XM_006712817 PREDICTED: Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 11 (ABCB11), transcript variant X1, mRNA. On-demand $1699.00 25
XM_006712818 PREDICTED: Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 11 (ABCB11), transcript variant X2, mRNA. On-demand $1699.00 25
Title Differential roles of ubiquitination in the degradation mechanism of cell surface-resident bile salt export pump and multidrug resistance-associated protein 2 .
Author Aida K, Hayashi H, Inamura K, Mizuno T and Sugiyama Y.
Journal Mol. Pharmacol. 85 (3), 482-491 (2014)
Title A comprehensive analysis of common genetic variation around six candidate loci for intrahepatic cholestasis of pregnancy .
Author Dixon PH, Wadsworth CA, Chambers J, Donnelly J, Cooley S, Buckley R, Mannino R, Jarvis S, Syngelaki A, Geenes V, Paul P, Sothinathan M, Kubitz R, Lammert F, Tribe RM, Ch'ng CL, Marschall HU, Glantz A, Khan SA, Nicolaides K, Whittaker J, Geary M and Williamson C.
Journal Am. J. Gastroenterol. 109 (1), 76-84 (2014)
Title Discovery and refinement of loci associated with lipid levels .
Author Willer CJ, Schmidt EM, Sengupta S, Peloso GM, Gustafsson S, Kanoni S, Ganna A, Chen J, Buchkovich ML, Mora S, Beckmann JS, Bragg-Gresham JL, Chang HY, Demirkan A, Den Hertog HM, Do R, Donnelly LA, Ehret GB, Esko T, Feitosa MF, Ferreira T, Fischer K, Fontanillas P, Fraser RM, Freitag DF, Gurdasani D, Heikkila K, Hypponen E, Isaacs A, Jackson AU, Johansson A, Johnson T, Kaakinen M, Kettunen J, Kleber ME, Li X, Luan J, Lyytikainen LP, Magnusson PK, Mangino M, Mihailov E, Montasser ME, Muller-Nurasyid M, Nolte IM, O'Connell JR, Palmer CD, Perola M, Petersen AK, Sanna S, Saxena R, Service SK, Shah S, Shungin D, Sidore C, Song C, Strawbridge RJ, Surakka I, Tanaka T, Teslovich TM, Thorleifsson G, Van den Herik EG, Voight BF, Volcik KA, Waite LL, Wong A, Wu Y, Zhang W, Absher D, Asiki G, Barroso I, Been LF, Bolton JL, Bonnycastle LL, Brambilla P, Burnett MS, Cesana G, Dimitriou M, Doney AS, Doring A, Elliott P, Epstein SE, Eyjolfsson GI, Gigante B, Goodarzi MO, Grallert H, Gravito ML, Groves CJ, Hallmans G, Hartikainen AL, Hayward C, Hernandez D, Hicks AA, Holm H, Hung YJ, Illig T, Jones MR, Kaleebu P, Kastelein JJ, Khaw KT, Kim E, Klopp N, Komulainen P, Kumari M, Langenberg C, Lehtimaki T, Lin SY, Lindstrom J, Loos RJ, Mach F, McArdle WL, Meisinger C, Mitchell BD, Muller G, Nagaraja R, Narisu N, Nieminen TV, Nsubuga RN, Olafsson I, Ong KK, Palotie A, Papamarkou T, Pomilla C, Pouta A, Rader DJ, Reilly MP, Ridker PM, Rivadeneira F, Rudan I, Ruokonen A, Samani N, Scharnagl H, Seeley J, Silander K, Stancakova A, Stirrups K, Swift AJ, Tiret L, Uitterlinden AG, van Pelt LJ, Vedantam S, Wainwright N, Wijmenga C, Wild SH, Willemsen G, Wilsgaard T, Wilson JF, Young EH, Zhao JH, Adair LS, Arveiler D, Assimes TL, Bandinelli S, Bennett F, Bochud M, Boehm BO, Boomsma DI, Borecki IB, Bornstein SR, Bovet P, Burnier M, Campbell H, Chakravarti A, Chambers JC, Chen YD, Collins FS, Cooper RS, Danesh J, Dedoussis G, de Faire U, Feranil AB, Ferrieres J, Ferrucci L, Freimer NB, Gieger C, Groop LC, Gudnason V, Gyllensten U, Hamsten A, Harris TB, Hingorani A, Hirschhorn JN, Hofman A, Hovingh GK, Hsiung CA, Humphries SE, Hunt SC, Hveem K, Iribarren C, Jarvelin MR, Jula A, Kahonen M, Kaprio J, Kesaniemi A, Kivimaki M, Kooner JS, Koudstaal PJ, Krauss RM, Kuh D, Kuusisto J, Kyvik KO, Laakso M, Lakka TA, Lind L, Lindgren CM, Martin NG, Marz W, McCarthy MI, McKenzie CA, Meneton P, Metspalu A, Moilanen L, Morris AD, Munroe PB, Njolstad I, Pedersen NL, Power C, Pramstaller PP, Price JF, Psaty BM, Quertermous T, Rauramaa R, Saleheen D, Salomaa V, Sanghera DK, Saramies J, Schwarz PE, Sheu WH, Shuldiner AR, Siegbahn A, Spector TD, Stefansson K, Strachan DP, Tayo BO, Tremoli E, Tuomilehto J, Uusitupa M, van Duijn CM, Vollenweider P, Wallentin L, Wareham NJ, Whitfield JB, Wolffenbuttel BH, Ordovas JM, Boerwinkle E, Palmer CN, Thorsteinsdottir U, Chasman DI, Rotter JI, Franks PW, Ripatti S, Cupples LA, Sandhu MS, Rich SS, Boehnke M, Deloukas P, Kathiresan S, Mohlke KL, Ingelsson E and Abecasis GR.
Journal Nat. Genet. 45 (11), 1274-1283 (2013)
Title Mechanistic insights into isoform-dependent and species-specific regulation of bile salt export pump by farnesoid X receptor .
Author Song X, Chen Y, Valanejad L, Kaimal R, Yan B, Stoner M and Deng R.
Journal J. Lipid Res. 54 (11), 3030-3044 (2013)
Title Genome-wide meta-analysis of systolic blood pressure in children with sickle cell disease .
Author Bhatnagar P, Barron-Casella E, Bean CJ, Milton JN, Baldwin CT, Steinberg MH, Debaun M, Casella JF and Arking DE.
Journal PLoS ONE 8 (9), E74193 (2013)
Title Targeted inactivation of sister of P-glycoprotein gene (spgp) in mice results in nonprogressive but persistent intrahepatic cholestasis .
Author Wang R, Salem M, Yousef IM, Tuchweber B, Lam P, Childs SJ, Helgason CD, Ackerley C, Phillips MJ and Ling V.
Journal Proc. Natl. Acad. Sci. U.S.A. 98 (4), 2011-2016 (2001)
Title Hepatocanalicular bile salt export pump deficiency in patients with progressive familial intrahepatic cholestasis .
Author Jansen PL, Strautnieks SS, Jacquemin E, Hadchouel M, Sokal EM, Hooiveld GJ, Koning JH, De Jager-Krikken A, Kuipers F, Stellaard F, Bijleveld CM, Gouw A, Van Goor H, Thompson RJ and Muller M.
Journal Gastroenterology 117 (6), 1370-1379 (1999)
Title A gene encoding a liver-specific ABC transporter is mutated in progressive familial intrahepatic cholestasis .
Author Strautnieks SS, Bull LN, Knisely AS, Kocoshis SA, Dahl N, Arnell H, Sokal E, Dahan K, Childs S, Ling V, Tanner MS, Kagalwalla AF, Nemeth A, Pawlowska J, Baker A, Mieli-Vergani G, Freimer NB, Gardiner RM and Thompson RJ.
Journal Nat. Genet. 20 (3), 233-238 (1998)
Title The sister of P-glycoprotein represents the canalicular bile salt export pump of mammalian liver .
Author Gerloff T, Stieger B, Hagenbuch B, Madon J, Landmann L, Roth J, Hofmann AF and Meier PJ.
Journal J. Biol. Chem. 273 (16), 10046-10050 (1998)
Title ATP8B1 Deficiency .
Author Knisely,A.S., Bull,L.N. and Shneider,B.L.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.