Homo sapiens eukaryotic translation initiation factor 3, subunit B (EIF3B), transcript variant 1, mRNA.
| RefSeq Version | NM_003751.3, 83367073 |
| Length | 3009 bp |
| Structure | linear |
| Update Date | 11-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens eukaryotic translation initiation factor 3, subunit B (EIF3B), transcript variant 1, mRNA. |
| Product | eukaryotic translation initiation factor 3 subunit B |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. This record has been curated by NCBI staff in collaboration with Francesco Amaldi. The reference sequence was derived from AC004971.3, U78525.1 and BQ015102.1. On Dec 8, 2005 this sequence version replaced gi:33239444. |
| RefSeq | NP_003742.2 |
| CDS | 84..2528 | Exon (1) | 1..582 | Exon (2) | 1..582 | Exon (3) | 583..775 | Exon (4) | 776..895 | Exon (5) | 896..953 | Exon (6) | 954..1082 | Exon (7) | 1083..1240 | Exon (8) | 1241..1372 | Exon (9) | 1373..1439 | Exon (10) | 1440..1486 | Exon (11) | 1487..1697 | Exon (12) | 1698..1770 | Exon (13) | 1771..1893 | Exon (14) | 1894..1972 | Exon (15) | 1973..2111 | Exon (16) | 2112..2237 | Exon (17) | 2238..2315 | Exon (18) | 2316..2424 | Exon (19) | 2425..2542 | Exon (20) | 2543..3009 |
| Translation | MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTEASSEEVGIAEA
GPESEVRTEPAAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQGEAPGEQARDERSDSR
AQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEA
DGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASP
AHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEA
ECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALW
GGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHC
ESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIA
FWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGV
VTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKI
ELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWD
PTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQEQIKQI
KKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRG
GVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 7 | + | a, t | dbSNP:11975205 |
| 114 | + | g, t | dbSNP:11551169 |
| 273 | + | c, t | dbSNP:9690787 |
| 388 | + | c, t | dbSNP:11551168 |
| 518 | + | c, t | dbSNP:11551167 |
| 570 | + | c, g | dbSNP:78680793 |
| 632 | + | c, t | dbSNP:58174334 |
| 884 | + | a, g | dbSNP:116770364 |
| 975 | + | g, t | dbSNP:77981709 |
| 981 | + | g, t | dbSNP:11551165 |
| 1082 | + | , largedeletion | dbSNP:71729834 |
| 1085 | + | a, g | dbSNP:11551170 |
| 1211 | + | c, t | dbSNP:61742669 |
| 1351 | + | c, t | dbSNP:11551171 |
| 1583 | + | c, t | dbSNP:75453494 |
| 1682 | + | c, t | dbSNP:1804773 |
| 1703 | + | g, t | dbSNP:77573843 |
| 1826 | + | c, t | dbSNP:61742731 |
| 1967 | + | a, g | dbSNP:114731734 |
| 2005 | + | c, t | dbSNP:76153980 |
| 2027 | + | c, t | dbSNP:112914667 |
| 2136 | + | a, g | dbSNP:115149021 |
| 2355..2356 | + | , g | dbSNP:34214335 |
| 2462 | + | a, c | dbSNP:1063257 |
| 2542 | + | , largedeletion | dbSNP:71748700 |
| 2550 | + | a, g | dbSNP:76988192 |
| 2573 | + | g, t | dbSNP:111842567 |
| 2726 | + | g, t | dbSNP:1804774 |
| 2839 | + | g, t | dbSNP:76427867 |
| 2920 | + | a, g | dbSNP:2301945 |
| Gene Symbol | EIF3B |
| Gene Synonym | EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; MGC104664; MGC131875; PRT1 |
| Chromosome | 7 |
| Locus Map | 7p22.3 |
| All Transcripts | NM_003751 , NM_001037283 |
| Title | The indispensable N-terminal half of eIF3j/HCR1 cooperates with its structurally conserved binding partner eIF3b/PRT1-RRM and with eIF1A in stringent AUG selection . |
| Author | Elantak,L., Wagner,S., Herrmannova,A., Karaskova,M., Rutkai,E., Lukavsky,P.J. and Valasek,L. |
| Journal | J. Mol. Biol. 396 (4), 1097-1116 (2010) |
| Title | Crystal structure of the RNA recognition motif of yeast translation initiation factor eIF3b reveals differences to human eIF3b . |
| Author | Khoshnevis,S., Neumann,P. and Ficner,R. |
| Journal | PLoS ONE 5 (9) (2010) |
| Title | Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3 . |
| Author | Zhou,M., Sandercock,A.M., Fraser,C.S., Ridlova,G., Stephens,E., Schenauer,M.R., Yokoi-Fong,T., Barsky,D., Leary,J.A., Hershey,J.W., Doudna,J.A. and Robinson,C.V. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 105 (47), 18139-18144 (2008) |
| Title | Reconstitution reveals the functional core of mammalian eIF3 . |
| Author | Masutani,M., Sonenberg,N., Yokoyama,S. and Imataka,H. |
| Journal | EMBO J. 26 (14), 3373-3383 (2007) |
| Title | Structural characterization of the human eukaryotic initiation factor 3 protein complex by mass spectrometry . |
| Author | Damoc,E., Fraser,C.S., Zhou,M., Videler,H., Mayeur,G.L., Hershey,J.W., Doudna,J.A., Robinson,C.V. and Leary,J.A. |
| Journal | Mol. Cell Proteomics 6 (7), 1135-1146 (2007) |
| Title | Characterization of cDNAs encoding the p44 and p35 subunits of human translation initiation factor eIF3 . |
| Author | Block,K.L., Vornlocher,H.P. and Hershey,J.W. |
| Journal | J. Biol. Chem. 273 (48), 31901-31908 (1998) |
| Title | Biochemical characterization of mammalian translation initiation factor 3 (eIF3). Molecular cloning reveals that p110 subunit is the mammalian homologue of Saccharomyces cerevisiae protein Prt1 . |
| Author | Chaudhuri,J., Chakrabarti,A. and Maitra,U. |
| Journal | J. Biol. Chem. 272 (49), 30975-30983 (1997) |
| Title | The human homologue of the yeast Prt1 protein is an integral part of the eukaryotic initiation factor 3 complex and interacts with p170 . |
| Author | Methot,N., Rom,E., Olsen,H. and Sonenberg,N. |
| Journal | J. Biol. Chem. 272 (2), 1110-1116 (1997) |
| Title | Conservation and diversity of eukaryotic translation initiation factor eIF3 . |
| Author | Asano,K., Kinzy,T.G., Merrick,W.C. and Hershey,J.W. |
| Journal | J. Biol. Chem. 272 (2), 1101-1109 (1997) |
| Title | Characterization of an interleukin-2 (IL-2)-induced tyrosine phosphorylated 116-kDa protein associated with the IL-2 receptor beta-subunit . |
| Author | Kirken,R.A., Rui,H., Evans,G.A. and Farrar,W.L. |
| Journal | J. Biol. Chem. 268 (30), 22765-22770 (1993) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |