• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens eukaryotic translation initiation factor 3, subunit B (EIF3B), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003751 Homo sapiens eukaryotic translation initiation factor 3, subunit B (EIF3B), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_003751.3, 83367073
Length 3009 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens eukaryotic translation initiation factor 3, subunit B (EIF3B), transcript variant 1, mRNA.
Product eukaryotic translation initiation factor 3 subunit B
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. This record has been curated by NCBI staff in collaboration with Francesco Amaldi. The reference sequence was derived from AC004971.3, U78525.1 and BQ015102.1. On Dec 8, 2005 this sequence version replaced gi:33239444.

RefSeq NP_003742.2
CDS 84..2528
Misc Feature(1)1
Misc Feature(2)1
Misc Feature(3)29
Misc Feature(4)84..86
Misc Feature(5)84..86
Misc Feature(6)315..317
Misc Feature(7)324..326
Misc Feature(8)330..332
Misc Feature(9)330..332
Misc Feature(10)336..338
Misc Feature(11)336..338
Misc Feature(12)438..440
Misc Feature(13)438..440
Misc Feature(14)453..1322
Misc Feature(15)456..458
Misc Feature(16)456..458
Misc Feature(17)537..539
Misc Feature(18)537..539
Misc Feature(19)543..545
Misc Feature(20)543..545
Misc Feature(21)573..575
Misc Feature(22)573..575
Misc Feature(23)591..905
Misc Feature(24)<702..860
Misc Feature(25)708..710
Misc Feature(26)order(777..779,783..785)
Misc Feature(27)798..800
Misc Feature(28)945..947
Misc Feature(29)1005..2381
Misc Feature(30)1173..1175
Misc Feature(31)1197..1334
Misc Feature(32)1344..1460
Misc Feature(33)1656..1658
Misc Feature(34)1761..1886
Misc Feature(35)2028..2165
Exon (1)1..582
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (2)583..775
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (3)776..895
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (4)896..953
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (5)954..1082
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (6)1083..1240
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (7)1241..1372
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (8)1373..1439
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (9)1440..1486
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (10)1487..1697
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (11)1698..1770
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (12)1771..1893
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (13)1894..1972
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (14)1973..2111
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (15)2112..2237
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (16)2238..2315
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (17)2316..2424
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (18)2425..2542
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Exon (19)2543..3009
Gene:EIF3B
Gene Synonym:EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Translation MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTEASSEEVGIAEA GPESEVRTEPAAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQGEAPGEQARDERSDSR AQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEA DGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASP AHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEA ECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALW GGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHC ESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIA FWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGV VTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKI ELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWD PTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQEQIKQI KKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRG GVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
7+a, tdbSNP:11975205
114+g, tdbSNP:11551169
273+c, tdbSNP:9690787
388+c, tdbSNP:11551168
461+c, gdbSNP:185762794
518+c, tdbSNP:11551167
534+c, tdbSNP:191463396
570+c, gdbSNP:78680793
610+dbSNP:
610+a, gdbSNP:201331895
632+c, tdbSNP:58174334
639+g, tdbSNP:201155310
655+a, gdbSNP:143426217
665+c, gdbSNP:147152815
794+dbSNP:
794+c, tdbSNP:140288121
809+c, tdbSNP:146230401
811+c, tdbSNP:150739455
816+a, gdbSNP:200218143
824+a, gdbSNP:200969617
837+a, gdbSNP:200489277
884+a, gdbSNP:116770364
904+dbSNP:
904+c, tdbSNP:150027587
910+g, tdbSNP:151282164
914+c, tdbSNP:145413649
915+a, gdbSNP:148785184
975+dbSNP:
975+g, tdbSNP:77981709
981+g, tdbSNP:11551165
1003+c, gdbSNP:201467063
1010+c, tdbSNP:143894408
1050+a, gdbSNP:146798724
1058+a, cdbSNP:140490524
1064+c, gdbSNP:201106605
1085+dbSNP:
1085+a, gdbSNP:11551170
1115+c, tdbSNP:145719280
1211+c, tdbSNP:61742669
1241+dbSNP:
1241+a, gdbSNP:147656962
1243+a, gdbSNP:140314892
1259+c, tdbSNP:142377401
1274+a, gdbSNP:201449328
1296+a, gdbSNP:199814936
1340+c, tdbSNP:144904326
1351+c, tdbSNP:11551171
1484+dbSNP:
1484+a, gdbSNP:138033670
1496+dbSNP:
1496+c, tdbSNP:201839393
1511+c, tdbSNP:142311273
1520+c, tdbSNP:146119314
1583+c, tdbSNP:182549563
1682+c, tdbSNP:1804773
1703+dbSNP:
1703+g, tdbSNP:77573843
1784+dbSNP:
1784+c, tdbSNP:200089529
1826+c, tdbSNP:61742731
1827+a, gdbSNP:144505700
1838+a, gdbSNP:140168471
1841+g, tdbSNP:141948054
1858+a, gdbSNP:150678614
1940+dbSNP:
1940+a, gdbSNP:201057035
1967+a, gdbSNP:114731734
1991+dbSNP:
1991+a, gdbSNP:201791942
2005+c, tdbSNP:76153980
2014+c, tdbSNP:181409131
2027+c, tdbSNP:112914667
2052+a, gdbSNP:139537965
2136+dbSNP:
2136+c, tdbSNP:201207559
2194..2195+, gdbSNP:149919744
2209+c, gdbSNP:149974474
2216+c, gdbSNP:145251998
2264+dbSNP:
2264+c, tdbSNP:149152140
2267+c, tdbSNP:201291849
2339+dbSNP:
2339+c, gdbSNP:142336519
2355..2356+, gdbSNP:34214335
2374+c, tdbSNP:202106605
2381+a, gdbSNP:200135327
2403+a, gdbSNP:150993211
2414+a, gdbSNP:142147533
2439+dbSNP:
2439+a, gdbSNP:141884022
2459+c, tdbSNP:146207412
2462+a, cdbSNP:1063257
2550+dbSNP:
2550+a, gdbSNP:76988192
2573+g, tdbSNP:111842567
2599+a, gdbSNP:145996421
2656+c, tdbSNP:201303353
2726+g, tdbSNP:1804774
2756+c, tdbSNP:188112322
2768+c, tdbSNP:139942907
2783+a, gdbSNP:191639027
2805+g, tdbSNP:142858802
2815+a, gdbSNP:151071509
2839+g, tdbSNP:76427867
2920+a, gdbSNP:2301945
Gene SymbolEIF3B
Gene SynonymEIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Chromosome7
Locus Map7p22.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001037283 Homo sapiens eukaryotic translation initiation factor 3, subunit B (EIF3B), transcript variant 2, mRNA. On-demand TBD TBD
NM_003751 Homo sapiens eukaryotic translation initiation factor 3, subunit B (EIF3B), transcript variant 1, mRNA. On-demand TBD TBD
Title Knockdown of eukaryotic translation initiation factors 3B (EIF3B) inhibits proliferation and promotes apoptosis in glioblastoma cells .
Author Liang,H., Ding,X., Zhou,C., Zhang,Y., Xu,M., Zhang,C. and Xu,L.
Journal Neurol. Sci. 33 (5), 1057-1062 (2012)
Title The indispensable N-terminal half of eIF3j/HCR1 cooperates with its structurally conserved binding partner eIF3b/PRT1-RRM and with eIF1A in stringent AUG selection .
Author Elantak,L., Wagner,S., Herrmannova,A., Karaskova,M., Rutkai,E., Lukavsky,P.J. and Valasek,L.
Journal J. Mol. Biol. 396 (4), 1097-1116 (2010)
Title Crystal structure of the RNA recognition motif of yeast translation initiation factor eIF3b reveals differences to human eIF3b .
Author Khoshnevis,S., Neumann,P. and Ficner,R.
Journal PLoS ONE 5 (9) (2010)
Title Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3 .
Author Zhou,M., Sandercock,A.M., Fraser,C.S., Ridlova,G., Stephens,E., Schenauer,M.R., Yokoi-Fong,T., Barsky,D., Leary,J.A., Hershey,J.W., Doudna,J.A. and Robinson,C.V.
Journal Proc. Natl. Acad. Sci. U.S.A. 105 (47), 18139-18144 (2008)
Title Human DDX3 functions in translation and interacts with the translation initiation factor eIF3 .
Author Lee,C.S., Dias,A.P., Jedrychowski,M., Patel,A.H., Hsu,J.L. and Reed,R.
Journal Nucleic Acids Res. 36 (14), 4708-4718 (2008)
Title Characterization of cDNAs encoding the p44 and p35 subunits of human translation initiation factor eIF3 .
Author Block,K.L., Vornlocher,H.P. and Hershey,J.W.
Journal J. Biol. Chem. 273 (48), 31901-31908 (1998)
Title Biochemical characterization of mammalian translation initiation factor 3 (eIF3). Molecular cloning reveals that p110 subunit is the mammalian homologue of Saccharomyces cerevisiae protein Prt1 .
Author Chaudhuri,J., Chakrabarti,A. and Maitra,U.
Journal J. Biol. Chem. 272 (49), 30975-30983 (1997)
Title The human homologue of the yeast Prt1 protein is an integral part of the eukaryotic initiation factor 3 complex and interacts with p170 .
Author Methot,N., Rom,E., Olsen,H. and Sonenberg,N.
Journal J. Biol. Chem. 272 (2), 1110-1116 (1997)
Title Conservation and diversity of eukaryotic translation initiation factor eIF3 .
Author Asano,K., Kinzy,T.G., Merrick,W.C. and Hershey,J.W.
Journal J. Biol. Chem. 272 (2), 1101-1109 (1997)
Title Characterization of an interleukin-2 (IL-2)-induced tyrosine phosphorylated 116-kDa protein associated with the IL-2 receptor beta-subunit .
Author Kirken,R.A., Rui,H., Evans,G.A. and Farrar,W.L.
Journal J. Biol. Chem. 268 (30), 22765-22770 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.