• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens eukaryotic translation initiation factor 3, subunit G (EIF3G), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003755 Homo sapiens eukaryotic translation initiation factor 3, subunit G (EIF3G), mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_003755.3, 83281440
Length 1127 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens eukaryotic translation initiation factor 3, subunit G (EIF3G), mRNA.
Product eukaryotic translation initiation factor 3 subunit G
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. This record has been curated by NCBI staff in collaboration with Francesco Amaldi. The reference sequence was derived from AC020931.6, BC000733.2 and BE017996.1. On Dec 6, 2005 this sequence version replaced gi:49472821.

RefSeq NP_003746.2
CDS 65..1027
Misc Feature(1)1
Misc Feature(2)1
Misc Feature(3)21
Misc Feature(4)176..178
Misc Feature(5)176..178
Misc Feature(6)185..187
Misc Feature(7)185..187
Misc Feature(8)185..187
Misc Feature(9)188..190
Misc Feature(10)188..190
Misc Feature(11)248..583
Misc Feature(12)602..>1015
Misc Feature(13)782..1012
Exon (1)1..84
Gene:EIF3G
Gene Synonym:eIF3-delta; EIF3-P42; eIF3-p44; EIF3S4
Exon (2)85..131
Gene:EIF3G
Gene Synonym:eIF3-delta; EIF3-P42; eIF3-p44; EIF3S4
Exon (3)132..215
Gene:EIF3G
Gene Synonym:eIF3-delta; EIF3-P42; eIF3-p44; EIF3S4
Exon (4)216..304
Gene:EIF3G
Gene Synonym:eIF3-delta; EIF3-P42; eIF3-p44; EIF3S4
Exon (5)305..364
Gene:EIF3G
Gene Synonym:eIF3-delta; EIF3-P42; eIF3-p44; EIF3S4
Exon (6)365..469
Gene:EIF3G
Gene Synonym:eIF3-delta; EIF3-P42; eIF3-p44; EIF3S4
Exon (7)470..659
Gene:EIF3G
Gene Synonym:eIF3-delta; EIF3-P42; eIF3-p44; EIF3S4
Exon (8)660..767
Gene:EIF3G
Gene Synonym:eIF3-delta; EIF3-P42; eIF3-p44; EIF3S4
Exon (9)768..904
Gene:EIF3G
Gene Synonym:eIF3-delta; EIF3-P42; eIF3-p44; EIF3S4
Exon (10)905..1011
Gene:EIF3G
Gene Synonym:eIF3-delta; EIF3-P42; eIF3-p44; EIF3S4
Exon (11)1012..1127
Gene:EIF3G
Gene Synonym:eIF3-delta; EIF3-P42; eIF3-p44; EIF3S4
Translation MPTGDFDSKPSWADQVEEEGEDDKCVTSELLKGIPLATGDTSPEPELLPGAPLPPPKEVI NGNIKTVTEYKIDEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATT TVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQK ELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNAT IRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGV SGFGYDHLILNVEWAKPSTN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(4)-c, adbSNP:191367288
complement(33)-g, cdbSNP:377631850
complement(42)-g, adbSNP:375341110
complement(50)-t, cdbSNP:111962472
complement(58)-c, adbSNP:199657181
complement(69)-g, adbSNP:200361874
complement(170)-dbSNP:
complement(170)-g, adbSNP:140589595
187+c, tdbSNP:11558270
229+dbSNP:
229+c, tdbSNP:11558273
267+c, tdbSNP:11558269
complement(268)-t, cdbSNP:34658893
complement(277)-t, cdbSNP:148715249
complement(283)-g, adbSNP:201202253
complement(287)-c, adbSNP:199860167
complement(295)-c, adbSNP:372087131
complement(311)-dbSNP:
complement(311)-g, c, adbSNP:145291485
complement(322)-t, cdbSNP:144272471
complement(332)-g, adbSNP:368465202
complement(337)-t, cdbSNP:139935811
complement(352)-g, cdbSNP:145988955
complement(379)-dbSNP:
complement(379)-g, adbSNP:142682262
complement(380)-t, cdbSNP:370039447
complement(382)-g, cdbSNP:139174106
complement(398)-g, cdbSNP:150720892
complement(403)-g, adbSNP:141171264
417+c, tdbSNP:11558272
complement(417)-g, adbSNP:386519293
complement(436)-g, adbSNP:143183271
complement(439)-g, adbSNP:377318103
complement(450)-g, adbSNP:369663424
complement(455)-t, gdbSNP:201238271
complement(462)-t, cdbSNP:376758358
complement(484)-dbSNP:
complement(484)-t, cdbSNP:148192612
complement(496)-g, adbSNP:145896417
complement(526)-g, adbSNP:200494795
complement(547)-t, cdbSNP:200081419
complement(565)-g, adbSNP:368376665
complement(613)-g, adbSNP:185092700
complement(626)-g, adbSNP:143486896
complement(662)-dbSNP:
complement(662)-g, cdbSNP:375316477
complement(667)-c, adbSNP:374292482
complement(673)-t, cdbSNP:375266384
complement(682)-t, cdbSNP:147076389
complement(687)-t, cdbSNP:149009824
complement(703)-g, adbSNP:370607828
complement(709)-t, cdbSNP:28510792
complement(718)-t, cdbSNP:372065668
complement(724)-g, adbSNP:200490441
complement(734)-g, adbSNP:150270880
complement(742)-t, cdbSNP:371439478
complement(749)-t, cdbSNP:192366729
complement(769)-dbSNP:
complement(769)-g, adbSNP:140952996
complement(814)-t, cdbSNP:142974473
complement(823)-g, adbSNP:144308529
complement(826)-g, adbSNP:199542850
complement(850)-g, adbSNP:188476640
complement(856)-g, adbSNP:17850344
complement(857)-t, adbSNP:200368684
complement(868)-g, adbSNP:369841100
complement(871)-g, adbSNP:117805948
complement(888)-t, gdbSNP:146486140
910+dbSNP:
910+c, tdbSNP:7710
complement(916)-g, adbSNP:145694767
complement(922)-g, adbSNP:149389283
complement(941)-t, cdbSNP:370696834
complement(958)-g, adbSNP:377391445
complement(979)-g, adbSNP:144649796
complement(1000)-g, adbSNP:149739513
complement(1009)-g, adbSNP:201663676
complement(1015)-dbSNP:
complement(1015)-t, cdbSNP:199502040
complement(1020)-t, gdbSNP:368352623
complement(1031)-t, cdbSNP:373177628
1040+c, tdbSNP:7401
complement(1049)-c, adbSNP:201130706
complement(1053)-g, adbSNP:200069826
complement(1054)-t, cdbSNP:374059230
complement(1057)-t, cdbSNP:200432266
complement(1082)-g, adbSNP:373508748
complement(1085)-g, cdbSNP:369484038
1087+g, tdbSNP:1804973
complement(1110)-t, cdbSNP:150201927
complement(1118)-t, adbSNP:183545591
complement(1123..1126)-, agagdbSNP:150000415
Gene SymbolEIF3G
Gene SynonymeIF3-delta; EIF3-P42; eIF3-p44; EIF3S4
Chromosome19
Locus Map19p13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003755 Homo sapiens eukaryotic translation initiation factor 3, subunit G (EIF3G), mRNA. On-demand $549.00 14
Title Caspase-mediated cleavage and DNase activity of the translation initiation factor 3, subunit G (eIF3g) .
Author Kim JT, Lee SJ, Kim BY, Lee CH, Yeom YI, Choe YK, Yoon DY, Chae SK, Kim JW, Yang Y, Lim JS and Lee HG.
Journal FEBS Lett. 587 (22), 3668-3674 (2013)
Title Translation initiation on mRNAs bound by nuclear cap-binding protein complex CBP80/20 requires interaction between CBP80/20-dependent translation initiation factor and eukaryotic translation initiation factor 3g .
Author Choe J, Oh N, Park S, Lee YK, Song OK, Locker N, Chi SG and Kim YK.
Journal J. Biol. Chem. 287 (22), 18500-18509 (2012)
Title Pelota interacts with HAX1, EIF3G and SRPX and the resulting protein complexes are associated with the actin cytoskeleton .
Author Burnicka-Turek O, Kata A, Buyandelger B, Ebermann L, Kramann N, Burfeind P, Hoyer-Fender S, Engel W and Adham IM.
Journal BMC Cell Biol. 11, 28 (2010)
Title Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3 .
Author Zhou M, Sandercock AM, Fraser CS, Ridlova G, Stephens E, Schenauer MR, Yokoi-Fong T, Barsky D, Leary JA, Hershey JW, Doudna JA and Robinson CV.
Journal Proc. Natl. Acad. Sci. U.S.A. 105 (47), 18139-18144 (2008)
Title Human DDX3 functions in translation and interacts with the translation initiation factor eIF3 .
Author Lee CS, Dias AP, Jedrychowski M, Patel AH, Hsu JL and Reed R.
Journal Nucleic Acids Res. 36 (14), 4708-4718 (2008)
Title Protein 4.1R binding to eIF3-p44 suggests an interaction between the cytoskeletal network and the translation apparatus .
Author Hou CL, Tang Cj, Roffler SR and Tang TK.
Journal Blood 96 (2), 747-753 (2000)
Title Cloning and characterization of the p42 subunit of mammalian translation initiation factor 3 (eIF3): demonstration that eIF3 interacts with eIF5 in mammalian cells .
Author Bandyopadhyay A and Maitra U.
Journal Nucleic Acids Res. 27 (5), 1331-1337 (1999)
Title Characterization of cDNAs encoding the p44 and p35 subunits of human translation initiation factor eIF3 .
Author Block KL, Vornlocher HP and Hershey JW.
Journal J. Biol. Chem. 273 (48), 31901-31908 (1998)
Title The human homologue of the yeast Prt1 protein is an integral part of the eukaryotic initiation factor 3 complex and interacts with p170 .
Author Methot N, Rom E, Olsen H and Sonenberg N.
Journal J. Biol. Chem. 272 (2), 1110-1116 (1997)
Title Conservation and diversity of eukaryotic translation initiation factor eIF3 .
Author Asano K, Kinzy TG, Merrick WC and Hershey JW.
Journal J. Biol. Chem. 272 (2), 1101-1109 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.