• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens syntaxin 16 (STX16), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu10405 Homo sapiens syntaxin 16 (STX16), transcript variant 2, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu10405C Homo sapiens syntaxin 16 (STX16), transcript variant 2, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_003763.5, 325652071
Length 915 bp
Structure linear
Update Date 16-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens syntaxin 16 (STX16), transcript variant 2, mRNA.
Product syntaxin-16 isoform b
Comment

Summary: This gene encodes a protein that is a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for V-SNARES (vesicle-SNAP receptors) permitting specific synaptic vesicle docking and fusion. A microdeletion in the region of chromosome 20 where this gene is located has been associated with pseudohypoparathyroidism type Ib. Multiple transcript variants have been found for this gene. Read-through transcription also exists between this gene and the neighboring downstream aminopeptidase-like 1 (NPEPL1) gene. [provided by RefSeq, Mar 2011].


Transcript Variant: This variant (2) uses an alternate in-frame splice site and lacks an alternate in-frame exon in the 5' coding region, compared to variant 1, resulting in a shorter isoform (b, also referred to as isoform A), compared to isoform a.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_003754.2
CDS 755..1669
Misc Feature(1)749..751
Misc Feature(2)926..1210
Misc Feature(3)926..1210
Misc Feature(4)1388..1567
Misc Feature(5)order(1472..1474,1493..1495,1502..1504)
Misc Feature(6)1481..1483
Exon (1)1..835
Gene:STX16
Gene Synonym:SYN16
Exon (2)836..943
Gene:STX16
Gene Synonym:SYN16
Exon (3)944..1084
Gene:STX16
Gene Synonym:SYN16
Exon (4)1085..1247
Gene:STX16
Gene Synonym:SYN16
Exon (5)1248..1339
Gene:STX16
Gene Synonym:SYN16
Exon (6)1340..1483
Gene:STX16
Gene Synonym:SYN16
Exon (7)1484..1564
Gene:STX16
Gene Synonym:SYN16
Exon (8)1565..4904
Gene:STX16
Gene Synonym:SYN16
Translation MATRRLTDAFLLLRNNSIQNRQLLAEQLADDRMALVSGISLDPEAAIGVTKRPPPKWVDG VDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQ ALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTS VPLMDDGDDNTLYHRGFTEDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMI VEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRKMLVILILFVIIIVLIVVLVG VKSR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
11+dbSNP:
11+c, tdbSNP:6026428
12+c, tdbSNP:373008020
62+c, gdbSNP:149351460
205+a, gdbSNP:148071494
221+c, gdbSNP:190719996
291+a, gdbSNP:41296203
complement(400)-t, cdbSNP:141733765
405+a, cdbSNP:41296205
595+a, gdbSNP:368572667
692+c, tdbSNP:181473720
717+a, cdbSNP:200958706
730+a, cdbSNP:368579447
740+c, gdbSNP:372834496
749+g, tdbSNP:199908670
796..797+, gdbSNP:34799113
805+c, tdbSNP:147707535
859+dbSNP:
859+a, gdbSNP:113226323
892+a, gdbSNP:376636519
908+c, g, tdbSNP:115046538
925+g, tdbSNP:369804857
963+dbSNP:
963+a, gdbSNP:201383880
999+a, tdbSNP:376642578
1003+c, tdbSNP:116024618
1031+a, gdbSNP:373265054
1039+c, tdbSNP:375933572
1051+c, tdbSNP:148962992
1075+g, tdbSNP:143655605
1098+dbSNP:
1098+g, tdbSNP:138261014
1103+c, gdbSNP:367970007
1108+c, tdbSNP:200994851
1133+c, tdbSNP:141068956
1134+a, gdbSNP:41276950
1147+g, tdbSNP:138647604
1150+a, gdbSNP:372451144
1166+a, gdbSNP:200474760
1175+a, gdbSNP:116490884
1176+c, tdbSNP:368945834
1188+c, tdbSNP:115544293
1192+c, gdbSNP:150780232
1220+c, tdbSNP:201318063
1231+a, gdbSNP:2296524
1237+a, cdbSNP:372211731
1260+dbSNP:
1260+a, gdbSNP:114786310
1276+a, gdbSNP:147137636
1285+c, tdbSNP:146333716
1319+a, gdbSNP:145632985
1335+a, tdbSNP:185111037
1376+dbSNP:
1376+a, cdbSNP:200589976
1397+c, tdbSNP:188308261
1398+a, gdbSNP:115536505
1404+a, gdbSNP:147330346
1407+a, gdbSNP:202102691
1413+g, tdbSNP:148806774
1414+a, cdbSNP:142393313
1465+c, gdbSNP:202209533
1467+c, tdbSNP:371863588
1473+c, tdbSNP:151312981
1483+a, gdbSNP:6100159
1499+dbSNP:
1499+a, cdbSNP:375261884
1525+c, gdbSNP:368191193
1575+dbSNP:
1575+a, gdbSNP:375043017
1622+a, gdbSNP:370017047
1670+a, gdbSNP:372282293
1711+c, tdbSNP:112492984
1739+a, gdbSNP:114597931
1783+c, tdbSNP:191638951
1796+c, tdbSNP:184148265
1852+g, tdbSNP:1052642
1858+g, tdbSNP:11540745
1886+a, gdbSNP:145140409
1956+c, gdbSNP:188059584
1995+a, gdbSNP:113179349
2029+c, gdbSNP:59037653
2151..2154+, ctctdbSNP:35445452
2589+c, gdbSNP:180964010
2592+a, gdbSNP:73611749
2682+a, gdbSNP:6026441
2824+c, tdbSNP:376574525
2885+a, tdbSNP:370636011
2921+g, tdbSNP:56003308
2928+a, tdbSNP:190464999
3135+a, gdbSNP:181622354
3250+c, gdbSNP:73302110
3318+a, gdbSNP:372819078
3320+c, tdbSNP:377668430
3321+a, gdbSNP:186800651
3416+c, gdbSNP:140662326
3454+a, gdbSNP:6128397
3459+a, tdbSNP:145827696
complement(3466)-g, cdbSNP:148109645
3532+a, cdbSNP:141875151
3541+a, gdbSNP:111581937
3555+c, tdbSNP:150647186
complement(3568)-t, cdbSNP:138678203
3597+c, tdbSNP:11578
3618+a, gdbSNP:4812024
3666+a, gdbSNP:78816069
3720+a, gdbSNP:190806693
3726+a, gdbSNP:7683
3729+c, tdbSNP:115404291
3749+a, gdbSNP:111631847
3759+a, gdbSNP:182673414
3852+a, gdbSNP:147429412
3868+c, tdbSNP:139818778
3962+a, gdbSNP:185815575
3965+a, cdbSNP:368106973
4018..4019+, aaadbSNP:368325478
4034+a, tdbSNP:189786439
4035..4036+, aaadbSNP:10695175
4138+c, tdbSNP:182635973
4208+c, tdbSNP:372202137
4212+c, gdbSNP:75424783
4277+a, tdbSNP:145217102
4296+c, gdbSNP:76626612
4416+c, tdbSNP:191994446
4417+a, gdbSNP:112728773
4445+a, cdbSNP:147183140
4487+c, tdbSNP:116627845
4554+c, tdbSNP:188362833
4606+c, tdbSNP:375254327
4618+c, gdbSNP:368447030
4631+c, tdbSNP:192204838
4689+, adbSNP:200171024
complement(4692)-t, cdbSNP:11817
complement(4749)-g, adbSNP:14943
complement(4779)-t, gdbSNP:148669648
4841..4842+, ttdbSNP:35295928
4863+c, tdbSNP:142088857
Gene SymbolSTX16
Gene SynonymSYN16
Chromosome20
Locus Map20q13.32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003763 Homo sapiens syntaxin 16 (STX16), transcript variant 2, mRNA. In-stock $99.00 5-7
NM_003763 Homo sapiens syntaxin 16 (STX16), transcript variant 2, mRNA. In-stock $99.00 5-7
NM_003763 Homo sapiens syntaxin 16 (STX16), transcript variant 2, mRNA. In-stock $99.00 5-7
NM_003763 Homo sapiens syntaxin 16 (STX16), transcript variant 2, mRNA. In-stock $99.00 5-7
NM_003763 Homo sapiens syntaxin 16 (STX16), transcript variant 2, mRNA. In-stock $99.00 5-7
Title VAMP4 is required to maintain the ribbon structure of the Golgi apparatus .
Author Shitara A, Shibui T, Okayama M, Arakawa T, Mizoguchi I, Sakakura Y and Takuma T.
Journal Mol. Cell. Biochem. 380 (1-2), 11-21 (2013)
Title Neuromuscular symptoms in a patient with familial pseudohypoparathyroidism type Ib diagnosed by methylation-specific multiplex ligation-dependent probe amplification .
Author Nagasaki K, Tsuchiya S, Saitoh A, Ogata T and Fukami M.
Journal Endocr. J. 60 (2), 231-236 (2013)
Title De novo STX16 deletions: an infrequent cause of pseudohypoparathyroidism type Ib that should be excluded in sporadic cases .
Author Turan S, Ignatius J, Moilanen JS, Kuismin O, Stewart H, Mann NP, Linglart A, Bastepe M and Juppner H.
Journal J. Clin. Endocrinol. Metab. 97 (12), E2314-E2319 (2012)
Title Syntaxin 16: unraveling cellular physiology through a ubiquitous .
Author Chen Y, Gan BQ and Tang BL.
Journal J. Cell. Physiol. 225 (2), 326-332 (2010)
Title Syntaxin 16 is enriched in neuronal dendrites and may have a role in neurite outgrowth .
Author Chua CE and Tang BL.
Journal Mol. Membr. Biol. 25 (1), 35-45 (2008)
Title Participation of the syntaxin 5/Ykt6/GS28/GS15 SNARE complex in transport from the early/recycling endosome to the trans-Golgi network .
Author Tai G, Lu L, Wang TL, Tang BL, Goud B, Johannes L and Hong W.
Journal Mol. Biol. Cell 15 (9), 4011-4022 (2004)
Title How Tlg2p/syntaxin 16 'snares' Vps45 .
Author Dulubova I, Yamaguchi T, Gao Y, Min SW, Huryeva I, Sudhof TC and Rizo J.
Journal EMBO J. 21 (14), 3620-3631 (2002)
Title Early/recycling endosomes-to-TGN transport involves two SNARE complexes and a Rab6 isoform .
Author Mallard F, Tang BL, Galli T, Tenza D, Saint-Pol A, Yue X, Antony C, Hong W, Goud B and Johannes L.
Journal J. Cell Biol. 156 (4), 653-664 (2002)
Title Syntaxin-16, a putative Golgi t-SNARE .
Author Simonsen A, Bremnes B, Ronning E, Aasland R and Stenmark H.
Journal Eur. J. Cell Biol. 75 (3), 223-231 (1998)
Title Molecular cloning and localization of human syntaxin 16, a member of the syntaxin family of SNARE proteins .
Author Tang BL, Low DY, Lee SS, Tan AE and Hong W.
Journal Biochem. Biophys. Res. Commun. 242 (3), 673-679 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.