• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens syntaxin 16 (STX16), transcript variant 2, mRNA.


RefSeq Accession Definition Services Price Order
NM_003763 Homo sapiens syntaxin 16 (STX16), transcript variant 2, mRNA. ORF Sequence $265.35
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_003763.5, 325652071
Length 4915 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens syntaxin 16 (STX16), transcript variant 2, mRNA.
Product syntaxin-16 isoform b
Comment

Summary: This gene encodes a protein that is a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for V-SNARES (vesicle-SNAP receptors) permitting specific synaptic vesicle docking and fusion. A microdeletion in the region of chromosome 20 where this gene is located has been associated with pseudohypoparathyroidism type Ib. Multiple transcript variants have been found for this gene. Read-through transcription also exists between this gene and the neighboring downstream aminopeptidase-like 1 (NPEPL1) gene. [provided by RefSeq, Mar 2011].


Transcript Variant: This variant (2) uses an alternate in-frame splice site and lacks an alternate in-frame exon in the 5' coding region, compared to variant 1, resulting in a shorter isoform (b, also referred to as isoform A), compared to isoform a.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_003754.2
CDS 755..1669
Misc Feature(1)749..751
Misc Feature(2)914..1210
Misc Feature(3)914..1210
Misc Feature(4)<1427..1567
Misc Feature(5)order(1472..1474,1493..1495,1502..1504)
Misc Feature(6)1481..1483
Exon (1)1..835
Gene:STX16
Gene Synonym:SYN16
Exon (2)836..943
Gene:STX16
Gene Synonym:SYN16
Exon (3)944..1084
Gene:STX16
Gene Synonym:SYN16
Exon (4)1085..1247
Gene:STX16
Gene Synonym:SYN16
Exon (5)1248..1339
Gene:STX16
Gene Synonym:SYN16
Exon (6)1340..1483
Gene:STX16
Gene Synonym:SYN16
Exon (7)1484..1564
Gene:STX16
Gene Synonym:SYN16
Exon (8)1565..4904
Gene:STX16
Gene Synonym:SYN16
Translation MATRRLTDAFLLLRNNSIQNRQLLAEQLADDRMALVSGISLDPEAAIGVTKRPPPKWVDG VDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQ ALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTS VPLMDDGDDNTLYHRGFTEDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMI VEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRKMLVILILFVIIIVLIVVLVG VKSR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
11+dbSNP:
11+c, tdbSNP:6026428
62+c, gdbSNP:149351460
205+a, gdbSNP:148071494
221+c, gdbSNP:190719996
291+a, gdbSNP:41296203
364..365+, gdbSNP:5842237
365..366+, gdbSNP:34540494
400+c, tdbSNP:141733765
405+a, cdbSNP:41296205
692+c, tdbSNP:181473720
717+a, cdbSNP:200958706
749+g, tdbSNP:199908670
795..796+, gdbSNP:34799113
805+c, tdbSNP:147707535
859+dbSNP:
859+a, gdbSNP:113226323
908+c, g, tdbSNP:115046538
963+dbSNP:
963+a, gdbSNP:201383880
1003+c, tdbSNP:116024618
1051+c, tdbSNP:148962992
1075+g, tdbSNP:143655605
1098+dbSNP:
1098+g, tdbSNP:138261014
1108+c, tdbSNP:200994851
1133+c, tdbSNP:141068956
1134+a, gdbSNP:41276950
1147+g, tdbSNP:138647604
1166+a, gdbSNP:200474760
1175+a, gdbSNP:116490884
1188+c, tdbSNP:115544293
1192+c, gdbSNP:150780232
1220+c, tdbSNP:201318063
1231+a, gdbSNP:2296524
1260+dbSNP:
1260+a, gdbSNP:114786310
1276+a, gdbSNP:147137636
1285+c, tdbSNP:146333716
1319+a, gdbSNP:145632985
1335+a, tdbSNP:185111037
1376+dbSNP:
1376+a, cdbSNP:200589976
1397+c, tdbSNP:188308261
1398+a, gdbSNP:115536505
1404+a, gdbSNP:147330346
1407+a, gdbSNP:202102691
1413+g, tdbSNP:148806774
1414+a, cdbSNP:142393313
1465+c, gdbSNP:202209533
1473+c, tdbSNP:151312981
1483+a, gdbSNP:6100159
1711+dbSNP:
1711+c, tdbSNP:112492984
1739+a, gdbSNP:114597931
1783+c, tdbSNP:191638951
1796+c, tdbSNP:184148265
1852..1853+g, tdbSNP:1052642
1852+g, tdbSNP:11540744
1858+g, tdbSNP:11540745
1886+a, gdbSNP:145140409
1956+c, gdbSNP:188059584
1995+a, gdbSNP:113179349
2029+c, gdbSNP:59037653
2067..2068+, aadbSNP:71766277
2150..2153+, tctcdbSNP:72386301
2151..2154+, ctctdbSNP:35445452
2589+c, gdbSNP:180964010
2592+a, gdbSNP:73611749
2682+a, gdbSNP:6026441
2921+g, tdbSNP:56003308
2928+a, tdbSNP:190464999
3135+a, gdbSNP:181622354
3250+c, gdbSNP:73302110
3321+a, gdbSNP:186800651
3416+c, gdbSNP:140662326
3454+a, gdbSNP:6128397
3459+a, tdbSNP:145827696
3466+c, gdbSNP:148109645
3532+a, cdbSNP:141875151
3541+a, gdbSNP:111581937
3555+c, tdbSNP:150647186
3568+c, tdbSNP:138678203
3597+c, tdbSNP:11578
3618+a, gdbSNP:4812024
3666+a, gdbSNP:78816069
3720+a, gdbSNP:190806693
3726+a, gdbSNP:7683
3729+c, tdbSNP:115404291
3749+a, gdbSNP:111631847
3759+a, gdbSNP:182673414
3852+a, gdbSNP:147429412
3868+c, tdbSNP:139818778
3962+a, gdbSNP:185815575
4018..4019+, aa, aaa, aaaadbSNP:11473470
4029..4030+, a, aaadbSNP:66674249
4034+a, tdbSNP:189786439
4035..4036+, aaa, aaaadbSNP:10695175
4138+c, tdbSNP:182635973
4212+c, gdbSNP:75424783
4277+a, tdbSNP:145217102
4296+c, gdbSNP:76626612
4416+c, tdbSNP:191994446
4417+a, gdbSNP:112728773
4445+a, cdbSNP:147183140
4487+c, tdbSNP:116627845
4554+c, tdbSNP:188362833
4631+c, tdbSNP:192204838
4689+, adbSNP:200171024
4692+c, tdbSNP:11817
4749+a, gdbSNP:14943
4779+g, tdbSNP:148669648
4841..4842+, ttdbSNP:142877078
4841+, t, ttdbSNP:35295928
4863+c, tdbSNP:142088857
Gene SymbolSTX16
Gene SynonymSYN16
Chromosome20
Locus Map20q13.32
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001001433 Homo sapiens syntaxin 16 (STX16), transcript variant 1, mRNA. Full Length $1742.30
ORF Sequence $283.62
NM_001134772 Homo sapiens syntaxin 16 (STX16), transcript variant 3, mRNA. Full Length $1738.10
ORF Sequence $280.14
NM_001134773 Homo sapiens syntaxin 16 (STX16), transcript variant 4, mRNA. Full Length $1724.45
ORF Sequence $268.83
NM_001204868 Homo sapiens syntaxin 16 (STX16), transcript variant 5, mRNA. Full Length $1519.00
ORF Sequence $237.51
NM_003763 Homo sapiens syntaxin 16 (STX16), transcript variant 2, mRNA. Full Length $1720.25
ORF Sequence $265.35
Title De novo STX16 deletions: an infrequent cause of pseudohypoparathyroidism type Ib that should be excluded in sporadic cases .
Author Turan,S., Ignatius,J., Moilanen,J.S., Kuismin,O., Stewart,H., Mann,N.P., Linglart,A., Bastepe,M. and Juppner,H.
Journal J. Clin. Endocrinol. Metab. 97 (12), E2314-E2319 (2012)
Title The cystic fibrosis transmembrane conductance regulator's expanding .
Author Tang,B.L., Gee,H.Y. and Lee,M.G.
Journal Traffic 12 (4), 364-371 (2011)
Title Osteosclerosis in two brothers with autosomal dominant pseudohypoparathyroidism type 1b: bone histomorphometric analysis .
Author Sbrocchi,A.M., Rauch,F., Lawson,M.L., Hadjiyannakis,S., Lawrence,S., Bastepe,M., Juppner,H. and Ward,L.M.
Journal Eur. J. Endocrinol. 164 (2), 295-301 (2011)
Title Syntaxin 16: unraveling cellular physiology through a ubiquitous .
Author Chen,Y., Gan,B.Q. and Tang,B.L.
Journal J. Cell. Physiol. 225 (2), 326-332 (2010)
Title Syntaxin 16 is enriched in neuronal dendrites and may have a role in neurite outgrowth .
Author Chua,C.E. and Tang,B.L.
Journal Mol. Membr. Biol. 25 (1), 35-45 (2008)
Title Participation of the syntaxin 5/Ykt6/GS28/GS15 SNARE complex in transport from the early/recycling endosome to the trans-Golgi network .
Author Tai,G., Lu,L., Wang,T.L., Tang,B.L., Goud,B., Johannes,L. and Hong,W.
Journal Mol. Biol. Cell 15 (9), 4011-4022 (2004)
Title How Tlg2p/syntaxin 16 'snares' Vps45 .
Author Dulubova,I., Yamaguchi,T., Gao,Y., Min,S.W., Huryeva,I., Sudhof,T.C. and Rizo,J.
Journal EMBO J. 21 (14), 3620-3631 (2002)
Title Early/recycling endosomes-to-TGN transport involves two SNARE complexes and a Rab6 isoform .
Author Mallard,F., Tang,B.L., Galli,T., Tenza,D., Saint-Pol,A., Yue,X., Antony,C., Hong,W., Goud,B. and Johannes,L.
Journal J. Cell Biol. 156 (4), 653-664 (2002)
Title Syntaxin-16, a putative Golgi t-SNARE .
Author Simonsen,A., Bremnes,B., Ronning,E., Aasland,R. and Stenmark,H.
Journal Eur. J. Cell Biol. 75 (3), 223-231 (1998)
Title Molecular cloning and localization of human syntaxin 16, a member of the syntaxin family of SNARE proteins .
Author Tang,B.L., Low,D.Y., Lee,S.S., Tan,A.E. and Hong,W.
Journal Biochem. Biophys. Res. Commun. 242 (3), 673-679 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878