• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor necrosis factor receptor superfamily, member 10b (TNFRSF10B), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_003842 Homo sapiens tumor necrosis factor receptor superfamily, member 10b (TNFRSF10B), transcript variant 1, mRNA. ORF Sequence $383.67
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_003842.4, 224494018
Length 4154 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tumor necrosis factor receptor superfamily, member 10b (TNFRSF10B), transcript variant 1, mRNA.
Product tumor necrosis factor receptor superfamily member 10B isoform 1 precursor
Comment

Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. [provided by RefSeq, Mar 2009].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longer isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_003833.4
CDS 294..1616
Misc Feature(1)264..266
Misc Feature(2)462..575
Misc Feature(3)507..764
Misc Feature(4)order(528..557,567..581,681..689)
Misc Feature(5)order(528..530,540..542,546..548,570..572,579..581,
Misc Feature(6)582..704
Misc Feature(7)order(600..602,633..635,660..662,726..728,750..752)
Misc Feature(8)order(609..614,630..638)
Misc Feature(9)705..827
Misc Feature(10)708..827
Misc Feature(11)order(726..728,750..764)
Misc Feature(12)867..911
Misc Feature(13)924..986
Misc Feature(14)1290..1577
Exon (1)1..437
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (2)438..543
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (3)544..657
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (4)658..769
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (5)770..1041
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (6)1042..1073
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (7)1074..1229
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (8)1230..1302
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (9)1303..4154
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Translation MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQD LAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCD SGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVH KESGTKHSGEVPAVEETVTSSPGTPASPCSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKV LPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGV NMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRK LGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIED HLLSSGKFMYLEGNADSAMS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(38)-dbSNP:
complement(38)-g, adbSNP:188679307
complement(103)-g, cdbSNP:185756438
complement(203)-t, cdbSNP:11135695
complement(208)-g, adbSNP:192055037
complement(274)-g, adbSNP:201588192
complement(287)-t, adbSNP:201446154
complement(294)-t, cdbSNP:143140468
complement(349)-t, cdbSNP:41308114
complement(388)-t, cdbSNP:1129424
complement(448)-dbSNP:
complement(448)-t, cdbSNP:201504540
complement(461)-g, adbSNP:150192996
complement(481)-g, cdbSNP:141261834
complement(493)-t, cdbSNP:1047266
complement(504)-g, adbSNP:201923391
complement(517)-t, cdbSNP:202151480
complement(563)-dbSNP:
complement(563)-g, adbSNP:145675791
complement(572)-g, adbSNP:78553663
complement(576)-t, cdbSNP:146841442
complement(580)-g, adbSNP:200014104
complement(700)-dbSNP:
complement(700)-g, adbSNP:142417651
complement(726)-g, adbSNP:149217492
complement(749)-c, adbSNP:145429085
complement(769)-c, adbSNP:184681902
complement(817)-dbSNP:
complement(817)-t, gdbSNP:150063854
complement(822)-t, cdbSNP:139403599
complement(826)-t, cdbSNP:147358455
complement(865)-g, c, adbSNP:13265018
complement(883)-g, adbSNP:61756238
complement(884)-t, cdbSNP:200151174
complement(885)-c, adbSNP:200164006
complement(895)-c, adbSNP:150556549
complement(950)-t, cdbSNP:141760693
complement(955)-t, cdbSNP:61761317
complement(970)-g, adbSNP:142057242
complement(978..979)-, aaaaaacccdbSNP:143636885
complement(980..981)-, ccdbSNP:141123579
complement(1058)-dbSNP:
complement(1058)-g, adbSNP:144580167
complement(1062)-g, adbSNP:141856351
complement(1063)-t, cdbSNP:185830763
complement(1083)-dbSNP:
complement(1083)-g, adbSNP:138183043
complement(1108)-c, adbSNP:145655756
complement(1112)-g, adbSNP:140589234
complement(1118)-t, cdbSNP:141284481
complement(1138)-t, gdbSNP:138851047
complement(1196)-g, adbSNP:150242748
complement(1212)-t, cdbSNP:199909973
complement(1233)-dbSNP:
complement(1233)-g, adbSNP:141046996
complement(1234)-g, adbSNP:141021862
complement(1235)-t, cdbSNP:151090486
complement(1305)-dbSNP:
complement(1305)-g, adbSNP:200472601
complement(1337)-t, cdbSNP:145630971
complement(1338)-c, adbSNP:141875903
complement(1347)-t, cdbSNP:201068780
complement(1420)-g, adbSNP:61756237
complement(1430)-g, cdbSNP:144232345
complement(1444)-g, adbSNP:201130588
complement(1451)-t, cdbSNP:140398163
complement(1516)-g, adbSNP:115227284
complement(1520)-t, cdbSNP:149907791
complement(1531)-t, adbSNP:148653452
complement(1590)-t, cdbSNP:150775344
complement(1613)-t, gdbSNP:141831388
complement(1627)-g, adbSNP:80214153
complement(1638)-g, cdbSNP:1047275
complement(1742)-t, gdbSNP:184982993
complement(1760)-g, adbSNP:4529462
complement(1855)-g, adbSNP:181505890
complement(1943)-t, adbSNP:189073621
complement(2066)-t, cdbSNP:4871844
complement(2102)-g, cdbSNP:57370403
complement(2120)-g, adbSNP:57455346
complement(2192)-g, adbSNP:11991499
complement(2221)-c, adbSNP:144967409
complement(2231)-t, cdbSNP:114018613
complement(2376)-t, cdbSNP:115164877
complement(2441)-t, cdbSNP:183996386
complement(2736)-t, adbSNP:192677235
complement(2916)-t, cdbSNP:188451803
complement(2947)-g, adbSNP:75721284
complement(2958)-g, adbSNP:184222585
complement(3058)-t, cdbSNP:192781747
complement(3096)-c, adbSNP:142791725
complement(3351)-g, cdbSNP:117494441
complement(3378)-g, adbSNP:187641176
complement(3427)-g, cdbSNP:1047305
complement(3474)-g, cdbSNP:35974498
complement(3576..3580)-, aaaagdbSNP:138865777
complement(3580)-g, adbSNP:183249409
complement(3604)-t, cdbSNP:138211776
complement(3614)-g, cdbSNP:113554268
complement(3723)-t, cdbSNP:7465134
complement(3741)-g, adbSNP:60740128
complement(3799)-t, adbSNP:28441503
complement(3930)-g, adbSNP:151293772
complement(3932)-t, cdbSNP:141093234
complement(4032)-t, cdbSNP:3187321
complement(4103)-t, adbSNP:115999720
complement(4149)-t, adbSNP:190340015
complement(4150)-t, cdbSNP:187339527
Gene SymbolTNFRSF10B
Gene SynonymCD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Chromosome8
Locus Map8p22-p21
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_003842 Homo sapiens tumor necrosis factor receptor superfamily, member 10b (TNFRSF10B), transcript variant 1, mRNA. Full Length $1453.90
ORF Sequence $383.67
NM_147187 Homo sapiens tumor necrosis factor receptor superfamily, member 10b (TNFRSF10B), transcript variant 2, mRNA. Full Length $1423.45
ORF Sequence $358.44
Title Small-molecule activation of the TRAIL receptor DR5 in human cancer cells .
Author Wang,G., Wang,X., Yu,H., Wei,S., Williams,N., Holmes,D.L., Halfmann,R., Naidoo,J., Wang,L., Li,L., Chen,S., Harran,P., Lei,X. and Wang,X.
Journal Nat. Chem. Biol. 9 (2), 84-89 (2013)
Title Up-regulation of a death receptor renders antiviral T cells susceptible to NK cell-mediated deletion .
Author Peppa,D., Gill,U.S., Reynolds,G., Easom,N.J., Pallett,L.J., Schurich,A., Micco,L., Nebbia,G., Singh,H.D., Adams,D.H., Kennedy,P.T. and Maini,M.K.
Journal J. Exp. Med. 210 (1), 99-114 (2013)
Title TRAIL: not just for tumors anymore? .
Author Benedict,C.A. and Ware,C.F.
Journal J. Exp. Med. 209 (11), 1903-1906 (2012)
Title The melanoma-associated antigen MAGE-D2 suppresses TRAIL receptor 2 and protects against TRAIL-induced apoptosis in human melanoma cells .
Author Tseng,H.Y., Chen,L.H., Ye,Y., Tay,K.H., Jiang,C.C., Guo,S.T., Jin,L., Hersey,P. and Zhang,X.D.
Journal Carcinogenesis 33 (10), 1871-1881 (2012)
Title Mitomycin C potentiates TRAIL-induced apoptosis through p53-independent upregulation of death receptors: evidence for the role of c-Jun N-terminal kinase activation .
Author Cheng,H., Hong,B., Zhou,L., Allen,J.E., Tai,G., Humphreys,R., Dicker,D.T., Liu,Y.Y. and El-Deiry,W.S.
Journal Cell Cycle 11 (17), 3312-3323 (2012)
Title TRAIL-R2: a novel apoptosis-mediating receptor for TRAIL .
Author Walczak,H., Degli-Esposti,M.A., Johnson,R.S., Smolak,P.J., Waugh,J.Y., Boiani,N., Timour,M.S., Gerhart,M.J., Schooley,K.A., Smith,C.A., Goodwin,R.G. and Rauch,C.T.
Journal EMBO J. 16 (17), 5386-5397 (1997)
Title TRICK2, a new alternatively spliced receptor that transduces the cytotoxic signal from TRAIL .
Author Screaton,G.R., Mongkolsapaya,J., Xu,X.N., Cowper,A.E., McMichael,A.J. and Bell,J.I.
Journal Curr. Biol. 7 (9), 693-696 (1997)
Title Control of TRAIL-induced apoptosis by a family of signaling and decoy receptors .
Author Sheridan,J.P., Marsters,S.A., Pitti,R.M., Gurney,A., Skubatch,M., Baldwin,D., Ramakrishnan,L., Gray,C.L., Baker,K., Wood,W.I., Goddard,A.D., Godowski,P. and Ashkenazi,A.
Journal Science 277 (5327), 818-821 (1997)
Title An antagonist decoy receptor and a death domain-containing receptor for TRAIL .
Author Pan,G., Ni,J., Wei,Y.F., Yu,G., Gentz,R. and Dixit,V.M.
Journal Science 277 (5327), 815-818 (1997)
Title Identification and characterization of a new member of the TNF family that induces apoptosis .
Author Wiley,S.R., Schooley,K., Smolak,P.J., Din,W.S., Huang,C.P., Nicholl,J.K., Sutherland,G.R., Smith,T.D., Rauch,C., Smith,C.A. et al.
Journal Immunity 3 (6), 673-682 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878