• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor necrosis factor receptor superfamily, member 10b (TNFRSF10B), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003842 Homo sapiens tumor necrosis factor receptor superfamily, member 10b (TNFRSF10B), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_003842.4, 224494018
Length 4154 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens tumor necrosis factor receptor superfamily, member 10b (TNFRSF10B), transcript variant 1, mRNA.
Product tumor necrosis factor receptor superfamily member 10B isoform 1 precursor
Comment

Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. [provided by RefSeq, Mar 2009].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longer isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_003833.4
CDS 294..1616
Misc Feature(1)264..266
Misc Feature(2)462..575
Misc Feature(3)486..764
Misc Feature(4)order(486..491,600..602,633..635,660..662,726..728,
Misc Feature(5)order(498..500,528..530,540..542,546..548,570..572,
Misc Feature(6)order(528..557,567..581,681..689)
Misc Feature(7)582..704
Misc Feature(8)order(609..614,630..638)
Misc Feature(9)705..827
Misc Feature(10)708..827
Misc Feature(11)order(726..728,750..764)
Misc Feature(12)867..911
Misc Feature(13)924..986
Misc Feature(14)1314..1577
Exon (1)1..437
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (2)438..543
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (3)544..657
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (4)658..769
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (5)770..1041
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (6)1042..1073
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (7)1074..1229
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (8)1230..1302
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Exon (9)1303..4154
Gene:TNFRSF10B
Gene Synonym:CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Translation MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQD LAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCD SGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVH KESGTKHSGEVPAVEETVTSSPGTPASPCSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKV LPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGV NMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRK LGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIED HLLSSGKFMYLEGNADSAMS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(38)-dbSNP:
complement(38)-g, adbSNP:188679307
complement(103)-g, cdbSNP:185756438
203+c, tdbSNP:11135695
complement(208)-g, adbSNP:192055037
complement(234)-t, gdbSNP:373901211
complement(256)-g, adbSNP:369511950
complement(259)-t, cdbSNP:374813688
complement(274)-g, adbSNP:201588192
complement(287)-t, adbSNP:201446154
complement(294)-t, cdbSNP:143140468
complement(349)-t, cdbSNP:41308114
complement(386)-c, adbSNP:373092672
388+c, tdbSNP:1129424
complement(448)-dbSNP:
complement(448)-t, cdbSNP:201504540
complement(453)-t, cdbSNP:377645383
complement(461)-g, adbSNP:150192996
complement(481)-g, cdbSNP:141261834
complement(493)-t, cdbSNP:386513167
493+c, tdbSNP:1047266
complement(504)-g, adbSNP:201923391
complement(517)-t, cdbSNP:202151480
complement(563)-dbSNP:
complement(563)-g, adbSNP:145675791
complement(572)-g, adbSNP:78553663
complement(576)-t, cdbSNP:146841442
complement(580)-g, adbSNP:200014104
complement(663)-dbSNP:
complement(663)-t, cdbSNP:377756817
complement(700)-g, adbSNP:142417651
complement(710)-g, adbSNP:375588751
complement(726)-g, adbSNP:149217492
complement(749)-c, adbSNP:145429085
complement(769)-c, adbSNP:184681902
complement(810)-dbSNP:
complement(810)-g, adbSNP:376968508
complement(817)-t, gdbSNP:150063854
complement(822)-t, cdbSNP:139403599
complement(826)-t, cdbSNP:147358455
complement(865)-g, c, adbSNP:13265018
complement(883)-g, adbSNP:61756238
complement(884)-t, cdbSNP:200151174
complement(885)-c, adbSNP:200164006
complement(895)-c, adbSNP:150556549
complement(906)-t, gdbSNP:375506479
complement(935)-g, adbSNP:369564714
complement(950)-t, cdbSNP:141760693
955+c, tdbSNP:61761317
complement(959)-g, adbSNP:372094119
complement(960)-t, cdbSNP:368188428
complement(970)-g, adbSNP:142057242
complement(978..979)-, aaaaaacccdbSNP:143636885
complement(980..981)-, ccdbSNP:141123579
complement(988)-g, cdbSNP:375815613
complement(1025)-c, adbSNP:371769682
complement(1058)-dbSNP:
complement(1058)-g, adbSNP:144580167
complement(1062)-g, adbSNP:141856351
complement(1063)-t, cdbSNP:185830763
complement(1083)-dbSNP:
complement(1083)-g, adbSNP:138183043
complement(1112)-g, adbSNP:140589234
1118+c, tdbSNP:141284481
complement(1138)-t, gdbSNP:138851047
complement(1196)-g, adbSNP:150242748
complement(1212)-t, cdbSNP:199909973
complement(1233)-dbSNP:
complement(1233)-g, adbSNP:141046996
complement(1234)-g, adbSNP:141021862
complement(1235)-t, cdbSNP:151090486
complement(1266)-g, adbSNP:372732199
complement(1305)-dbSNP:
complement(1305)-g, adbSNP:200472601
complement(1337)-t, cdbSNP:145630971
complement(1347)-t, cdbSNP:201068780
complement(1355)-t, cdbSNP:375688257
complement(1418)-t, cdbSNP:369451862
complement(1420)-g, adbSNP:61756237
complement(1430)-g, cdbSNP:144232345
complement(1444)-g, adbSNP:201130588
complement(1451)-t, cdbSNP:140398163
complement(1516)-g, adbSNP:115227284
complement(1520)-t, cdbSNP:149907791
complement(1531)-t, adbSNP:148653452
complement(1581)-t, adbSNP:371456402
complement(1590)-t, cdbSNP:150775344
complement(1613)-t, gdbSNP:141831388
complement(1621)-c, adbSNP:373566329
complement(1627)-g, adbSNP:80214153
1638+c, gdbSNP:1047275
complement(1700)-t, cdbSNP:374283069
complement(1742)-t, gdbSNP:184982993
complement(1760)-g, adbSNP:4529462
complement(1855)-g, adbSNP:181505890
complement(1943)-t, adbSNP:189073621
complement(2066)-t, cdbSNP:4871844
complement(2102)-g, cdbSNP:57370403
complement(2120)-g, adbSNP:57455346
complement(2192)-g, adbSNP:11991499
complement(2221)-c, adbSNP:144967409
complement(2231)-t, cdbSNP:114018613
complement(2376)-t, cdbSNP:115164877
complement(2441)-t, cdbSNP:183996386
complement(2494)-g, adbSNP:376249744
complement(2736)-t, adbSNP:192677235
complement(2916)-t, cdbSNP:188451803
complement(2947)-g, adbSNP:75721284
complement(2958)-g, adbSNP:184222585
complement(3058)-t, cdbSNP:192781747
complement(3096)-c, adbSNP:142791725
complement(3351)-g, cdbSNP:117494441
complement(3378)-g, adbSNP:187641176
3427+c, gdbSNP:1047305
complement(3474)-g, cdbSNP:35974498
complement(3576..3580)-, aaaagdbSNP:138865777
complement(3580)-g, adbSNP:183249409
complement(3604)-t, cdbSNP:138211776
complement(3614)-g, cdbSNP:113554268
complement(3723)-t, cdbSNP:7465134
complement(3741)-g, adbSNP:60740128
complement(3766)-g, adbSNP:367773525
complement(3780)-c, adbSNP:375732089
complement(3799)-t, adbSNP:28441503
complement(3926..3927)-, acaadbSNP:372651034
complement(3930)-g, adbSNP:151293772
3932+c, tdbSNP:141093234
complement(4032)-t, cdbSNP:386580633
4032+c, tdbSNP:3187321
complement(4103)-t, adbSNP:115999720
complement(4149)-t, adbSNP:190340015
complement(4150)-t, cdbSNP:187339527
Gene SymbolTNFRSF10B
Gene SynonymCD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9
Chromosome8
Locus Map8p22-p21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_147187 Homo sapiens tumor necrosis factor receptor superfamily, member 10b (TNFRSF10B), transcript variant 2, mRNA. On-demand $549.00 14
NM_003842 Homo sapiens tumor necrosis factor receptor superfamily, member 10b (TNFRSF10B), transcript variant 1, mRNA. On-demand $699.00 18
XM_006716409 PREDICTED: Homo sapiens tumor necrosis factor receptor superfamily, member 10b (TNFRSF10B), transcript variant X1, mRNA. On-demand $699.00 18
Title Nuclear death receptor TRAIL-R2 inhibits maturation of let-7 and promotes proliferation of pancreatic and other tumor cells .
Author Haselmann V, Kurz A, Bertsch U, Hubner S, Olempska-Muller M, Fritsch J, Hasler R, Pickl A, Fritsche H, Annewanter F, Engler C, Fleig B, Bernt A, Roder C, Schmidt H, Gelhaus C, Hauser C, Egberts JH, Heneweer C, Rohde AM, Boger C, Knippschild U, Rocken C, Adam D, Walczak H, Schutze S, Janssen O, Wulczyn FG, Wajant H, Kalthoff H and Trauzold A.
Journal Gastroenterology 146 (1), 278-290 (2014)
Title Activated Cdc42-associated kinase 1 (Ack1) is required for tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor recruitment to lipid rafts and induction of cell death .
Author Linderoth E, Pilia G, Mahajan NP and Ferby I.
Journal J. Biol. Chem. 288 (46), 32922-32931 (2013)
Title Azadirone, a limonoid tetranortriterpene, induces death receptors and sensitizes human cancer cells to tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) through a p53 protein-independent mechanism: evidence for the role of the ROS-ERK-CHOP-death receptor pathway .
Author Gupta SC, Francis SK, Nair MS, Mo YY and Aggarwal BB.
Journal J. Biol. Chem. 288 (45), 32343-32356 (2013)
Title Ibuprofen enhances TRAIL-induced apoptosis through DR5 upregulation .
Author Todo M, Horinaka M, Tomosugi M, Tanaka R, Ikawa H, Sowa Y, Ishikawa H, Fujiwara H, Otsuji E and Sakai T.
Journal Oncol. Rep. 30 (5), 2379-2384 (2013)
Title Noninvasive monitoring of pharmacodynamics and kinetics of a death receptor 5 antibody and its enhanced apoptosis induction in sequential application with doxorubicin .
Author Weber TG, Poschinger T, Galban S, Rehemtulla A and Scheuer W.
Journal Neoplasia 15 (8), 863-874 (2013)
Title TRAIL-R2: a novel apoptosis-mediating receptor for TRAIL .
Author Walczak H, Degli-Esposti MA, Johnson RS, Smolak PJ, Waugh JY, Boiani N, Timour MS, Gerhart MJ, Schooley KA, Smith CA, Goodwin RG and Rauch CT.
Journal EMBO J. 16 (17), 5386-5397 (1997)
Title TRICK2, a new alternatively spliced receptor that transduces the cytotoxic signal from TRAIL .
Author Screaton GR, Mongkolsapaya J, Xu XN, Cowper AE, McMichael AJ and Bell JI.
Journal Curr. Biol. 7 (9), 693-696 (1997)
Title Control of TRAIL-induced apoptosis by a family of signaling and decoy receptors .
Author Sheridan JP, Marsters SA, Pitti RM, Gurney A, Skubatch M, Baldwin D, Ramakrishnan L, Gray CL, Baker K, Wood WI, Goddard AD, Godowski
Journal Science 277 (5327), 818-821 (1997)
Title An antagonist decoy receptor and a death domain-containing receptor for TRAIL .
Author Pan G, Ni J, Wei YF, Yu G, Gentz R and Dixit VM.
Journal Science 277 (5327), 815-818 (1997)
Title Identification and characterization of a new member of the TNF family that induces apoptosis .
Author Wiley SR, Schooley K, Smolak PJ, Din WS, Huang CP, Nicholl JK, Sutherland GR, Smith TD, Rauch C and Smith CA.
Journal Immunity 3 (6), 673-682 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.