• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens sequestosome 1 (SQSTM1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003900 Homo sapiens sequestosome 1 (SQSTM1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_003900.4, 188497651
Length 2923 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens sequestosome 1 (SQSTM1), transcript variant 1, mRNA.
Product sequestosome-1 isoform 1
Comment

Summary: This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Alternatively spliced transcript variants encoding either the same or different isoforms have been identified for this gene. Mutations in this gene result in sporadic and familial Paget disease of bone. [provided by RefSeq, Mar 2009].


Transcript Variant: This variant (1) represents the predominant transcript, and encodes the longer isoform (1).

RefSeq NP_003891.1
CDS 96..1418
Misc Feature(1)99..245
Misc Feature(2)99..245
Misc Feature(3)99..101
Misc Feature(4)105..401
Misc Feature(5)177..179
Misc Feature(6)222..416
Misc Feature(7)243..335
Misc Feature(8)360..362
Misc Feature(9)459..767
Misc Feature(10)471..599
Misc Feature(11)order(477..479,486..488,519..521,528..530,546..548,
Misc Feature(12)order(477..479,486..488,546..548,555..557)
Misc Feature(13)order(480..482,510..512,516..518,534..536,540..542)
Misc Feature(14)order(513..515,588..590,597..599)
Misc Feature(15)order(519..521,528..530,573..575,582..584)
Misc Feature(16)537..539
Misc Feature(17)603..755
Misc Feature(18)603..605
Misc Feature(19)633..635
Misc Feature(20)639..641
Misc Feature(21)714..716
Misc Feature(22)777..794
Misc Feature(23)840..842
Misc Feature(24)891..893
Misc Feature(25)891..893
Misc Feature(26)900..1415
Misc Feature(27)900..902
Misc Feature(28)900..902
Misc Feature(29)900..902
Misc Feature(30)909..911
Misc Feature(31)909..911
Misc Feature(32)909..911
Misc Feature(33)918..920
Misc Feature(34)921..923
Misc Feature(35)924..926
Misc Feature(36)927..929
Misc Feature(37)939..941
Misc Feature(38)942..944
Misc Feature(39)945..947
Misc Feature(40)1047..1049
Misc Feature(41)1056..1121
Misc Feature(42)1077..1079
Misc Feature(43)1077..1079
Misc Feature(44)1089..1091
Misc Feature(45)1089..1091
Misc Feature(46)1110..1112
Misc Feature(47)1119..1121
Misc Feature(48)1122..1124
Misc Feature(49)1158..1160
Misc Feature(50)1176..1178
Misc Feature(51)1188..1190
Misc Feature(52)1191..1193
Misc Feature(53)1191..1193
Misc Feature(54)1203..1205
Misc Feature(55)1218..1220
Misc Feature(56)1275..1382
Misc Feature(57)1305..1313
Misc Feature(58)1308..1316
Exon (1)1..300
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Exon (2)301..396
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Exon (3)397..626
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Exon (4)627..768
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Exon (5)769..849
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Exon (6)850..1064
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Exon (7)1065..1260
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Exon (8)1261..2903
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Translation MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRP GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFS HSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNV GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNV EGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPE SEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK NYDIGAALDTIQYSKHPPPL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
4+dbSNP:
4+c, tdbSNP:368244826
17+a, gdbSNP:368632141
61+c, gdbSNP:189132632
71+a, gdbSNP:74523483
78+a, gdbSNP:370874635
85+c, tdbSNP:372806118
100+c, tdbSNP:377371202
145+c, tdbSNP:141502868
193+c, tdbSNP:200396166
201+a, gdbSNP:376158712
227+c, tdbSNP:11548639
309+dbSNP:
309+a, gdbSNP:376802604
310+c, gdbSNP:11548643
317+a, gdbSNP:371268375
333+a, gdbSNP:374178647
335+c, tdbSNP:148366738
336+a, gdbSNP:368853286
362+c, tdbSNP:150883783
363+a, gdbSNP:181263868
391+c, tdbSNP:11548641
398+dbSNP:
398+c, gdbSNP:11548637
423+c, tdbSNP:139372286
427+c, tdbSNP:371719657
431+a, gdbSNP:144289539
445+c, tdbSNP:147810437
446+a, gdbSNP:376214713
447+c, tdbSNP:200152247
467+a, c, tdbSNP:11548640
496+c, tdbSNP:372480231
497+c, tdbSNP:375411629
523+a, gdbSNP:370096430
524+a, cdbSNP:374417389
525+a, gdbSNP:200973006
551+c, tdbSNP:145037913
552+a, gdbSNP:145056421
complement(569)-g, adbSNP:35266480
577+a, g, tdbSNP:118160361
586+c, gdbSNP:376662069
591+c, gdbSNP:368741963
593+c, tdbSNP:372518286
603+a, gdbSNP:377198490
608+c, gdbSNP:199931327
612+a, gdbSNP:200731802
635+dbSNP:
635+a, gdbSNP:370203737
637+a, c, tdbSNP:113956324
657+a, gdbSNP:371832577
complement(674)-g, adbSNP:527602
675+a, gdbSNP:373585056
677+c, gdbSNP:11548634
687+c, tdbSNP:11548635
727+c, gdbSNP:368010261
729+c, tdbSNP:201263163
757+c, tdbSNP:199663339
769+dbSNP:
769+c, tdbSNP:202235745
778+c, tdbSNP:151191977
782+a, gdbSNP:140341924
791+a, gdbSNP:145688323
807+a, gdbSNP:11548633
814+c, tdbSNP:142719499
858+dbSNP:
858+c, gdbSNP:182522590
866+c, tdbSNP:372827450
878+c, tdbSNP:145001811
884+a, gdbSNP:200889080
894+c, tdbSNP:138928957
895+a, gdbSNP:149424705
901+c, tdbSNP:185313167
906+a, gdbSNP:376283809
908+c, gdbSNP:369606717
914+a, gdbSNP:200388590
917+c, gdbSNP:55793208
919+a, gdbSNP:201923000
922+a, cdbSNP:202119215
928+c, tdbSNP:200445838
942+a, gdbSNP:148559402
971+c, tdbSNP:4935
982+c, tdbSNP:376459756
983+a, gdbSNP:148984239
992+a, tdbSNP:139575774
1001+c, tdbSNP:11548642
1003+c, tdbSNP:143746604
1006+c, tdbSNP:150926394
1007+a, gdbSNP:370970067
1019+a, gdbSNP:139482113
1031+a, gdbSNP:4797
1037+c, tdbSNP:200695664
1041+c, tdbSNP:140315612
1049+c, tdbSNP:56092424
1050+a, gdbSNP:61748794
1056+c, tdbSNP:140226523
1079+dbSNP:
1079+a, gdbSNP:146164139
1080+c, gdbSNP:367902954
1081+a, gdbSNP:148294622
1091+a, gdbSNP:141436407
1133+a, gdbSNP:150470670
1139+a, gdbSNP:10058037
1178+c, tdbSNP:201591177
1183+a, gdbSNP:375495050
1200+c, tdbSNP:368657568
1203+c, tdbSNP:143956614
1224+c, gdbSNP:147305175
1256+a, gdbSNP:372271201
1270+dbSNP:
1270+c, tdbSNP:104893941
1271+a, gdbSNP:75700262
1273+a, gdbSNP:200551825
1296+a, cdbSNP:201795943
1310+c, tdbSNP:368933511
1326+a, gdbSNP:143511494
1340+a, gdbSNP:148278350
1352+c, tdbSNP:371720013
1367+c, tdbSNP:374985304
1372+c, tdbSNP:201239306
1373+a, gdbSNP:143977783
1409+a, gdbSNP:182058393
1411+c, tdbSNP:199854262
1412+g, tdbSNP:11548636
1432..1446+, cctcttctgcgtgccdbSNP:138527258
1438+a, cdbSNP:369114803
1456+c, tdbSNP:373148815
1457+c, gdbSNP:376209849
1461+g, tdbSNP:370200075
1478+c, tdbSNP:369609665
1484+a, cdbSNP:140407570
complement(1500)-g, adbSNP:11548622
complement(1501)-t, cdbSNP:155790
1593..1594+, tgdbSNP:386418446
1593+g, tdbSNP:186996560
1602..1603+, gtdbSNP:71714822
1606..1607+, tgdbSNP:10688915
1606..1607+, tgdbSNP:398109732
complement(1610)-t, cdbSNP:11249660
complement(1629)-t, cdbSNP:17409649
complement(1632)-t, gdbSNP:17409643
1676+c, tdbSNP:117531194
complement(1697)-g, cdbSNP:11548631
complement(1737)-t, cdbSNP:11548630
1737+c, tdbSNP:386519002
1805+a, gdbSNP:188873621
1806+c, tdbSNP:181341443
1814+g, tdbSNP:150371553
1920..1921+c, tdbSNP:10027
1923+c, tdbSNP:138055371
1924+a, gdbSNP:185559724
1957..1958+g, tdbSNP:11548632
complement(1957)-c, adbSNP:1060271
1959..1960+c, tdbSNP:11548621
1959+c, tdbSNP:14800
1961..1962+c, tdbSNP:11548625
1978+c, tdbSNP:14799
1979..1980+c, tdbSNP:11548627
1983..1984+c, tdbSNP:11548624
2009+c, tdbSNP:11548623
2010+a, gdbSNP:11548620
2031+c, tdbSNP:11548626
2039+c, tdbSNP:11548628
2042+c, tdbSNP:11548619
2051+c, tdbSNP:10173
2070+a, c, tdbSNP:14801
2080+a, tdbSNP:112765500
2085+a, tdbSNP:190193171
2128+c, gdbSNP:149508576
2141..2142+, tcttdbSNP:144467418
2204+a, gdbSNP:73334055
2205+c, tdbSNP:370269451
2255+a, gdbSNP:148611524
2266+a, gdbSNP:142061446
2274+c, tdbSNP:150786805
2280+g, tdbSNP:374714786
2291+c, tdbSNP:139424223
2371+g, tdbSNP:11548638
2374+c, tdbSNP:377076809
2375+a, gdbSNP:375294105
2378+a, gdbSNP:144080871
2404+c, tdbSNP:370481237
2405+a, gdbSNP:199727564
2440+a, gdbSNP:146092066
2458+c, gdbSNP:116069534
2471+c, tdbSNP:371482381
2491+a, gdbSNP:386455559
2491+c, tdbSNP:61746305
2507+c, tdbSNP:200300835
2519+a, gdbSNP:61742526
2529+c, gdbSNP:199887787
2549+c, gdbSNP:368323623
2556+c, tdbSNP:10277
2559+a, gdbSNP:143664576
2561+c, gdbSNP:372880666
2693+c, tdbSNP:376933990
2698+c, gdbSNP:371031967
2711+c, gdbSNP:201824663
2731+a, gdbSNP:376162024
complement(2740)-c, adbSNP:1065154
2754+c, tdbSNP:199862884
2812+c, tdbSNP:182968597
Gene SymbolSQSTM1
Gene SynonymA170; OSIL; p60; p62; p62B; PDB3; ZIP3
Chromosome5
Locus Map5q35
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003900 Homo sapiens sequestosome 1 (SQSTM1), transcript variant 1, mRNA. On-demand $699.00 18
NM_001142299 Homo sapiens sequestosome 1 (SQSTM1), transcript variant 3, mRNA. On-demand $549.00 14
NM_001142298 Homo sapiens sequestosome 1 (SQSTM1), transcript variant 2, mRNA. On-demand $549.00 14
Title Rapamycin attenuates mitochondrial dysfunction via activation of mitophagy in experimental ischemic stroke .
Author Li Q, Zhang T, Wang J, Zhang Z, Zhai Y, Yang GY and Sun X.
Journal Biochem. Biophys. Res. Commun. 444 (2), 182-188 (2014)
Title p62/SQSTM1 is required for cell survival of apoptosis-resistant bone metastatic prostate cancer cell lines .
Author Chang MA, Morgado M, Warren CR, Hinton CV, Farach-Carson MC and Delk NA.
Journal Prostate 74 (2), 149-163 (2014)
Title SQSTM1 is a pathogenic target of 5q copy number gains in kidney cancer .
Author Li L, Shen C, Nakamura E, Ando K, Signoretti S, Beroukhim R, Cowley GS, Lizotte P, Liberzon E, Bair S, Root DE, Tamayo P, Tsherniak A, Cheng SC, Tabak B, Jacobsen A, Hakimi AA, Schultz N, Ciriello G, Sander C, Hsieh JJ and Kaelin WG Jr.
Journal Cancer Cell 24 (6), 738-750 (2013)
Title Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease .
Author Lambert JC, Ibrahim-Verbaas CA, Harold D, Naj AC, Sims R, Bellenguez C, DeStafano AL, Bis JC, Beecham GW, Granier-Boley B, Russo G, Thorton-Wells TA, Jones N, Smith AV, Chouraki V, Thomas C, Ikram MA, Zelenika D, Vardarajan BN, Kamatani Y, Lin CF, Gerrish A, Schmidt H, Kunkle B, Dunstan ML, Ruiz A, Bihoreau MT, Choi SH, Reitz C, Pasquier F, Cruchaga C, Craig D, Amin N, Berr C, Lopez OL, De Jager PL, Deramecourt V, Johnston JA, Evans D, Lovestone S, Letenneur L, Moron FJ, Rubinsztein DC, Eiriksdottir G, Sleegers K, Goate AM, Fievet N, Huentelman MW, Gill M, Brown K, Kamboh MI, Keller L, Barberger-Gateau P, McGuiness B, Larson EB, Green R, Myers AJ, Dufouil C, Todd S, Wallon D, Love S, Rogaeva E, Gallacher J, St George-Hyslop P, Clarimon J, Lleo A, Bayer A, Tsuang DW, Yu L, Tsolaki M, Bossu P, Spalletta G, Proitsi P, Collinge J, Sorbi S, Sanchez-Garcia F, Fox NC, Hardy J, Deniz Naranjo MC, Bosco P, Clarke R, Brayne C, Galimberti D, Mancuso M, Matthews F, Moebus S, Mecocci P, Del Zompo M, Maier W, Hampel H, Pilotto A, Bullido M, Panza F, Caffarra P, Nacmias B, Gilbert JR, Mayhaus M, Lannefelt L, Hakonarson H, Pichler S, Carrasquillo MM, Ingelsson M, Beekly D, Alvarez V, Zou F, Valladares O, Younkin SG, Coto E, Hamilton-Nelson KL, Gu W, Razquin C, Pastor P, Mateo I, Owen MJ, Faber KM, Jonsson PV, Combarros O, O'Donovan MC, Cantwell LB, Soininen H, Blacker D, Mead S, Mosley TH Jr, Bennett DA, Harris TB, Fratiglioni L, Holmes C, de Bruijn RF, Passmore P, Montine TJ, Bettens K, Rotter JI, Brice A, Morgan K, Foroud TM, Kukull WA, Hannequin D, Powell JF, Nalls MA, Ritchie K, Lunetta KL, Kauwe JS, Boerwinkle E, Riemenschneider M, Boada M, Hiltuenen M, Martin ER, Schmidt R, Rujescu D, Wang LS, Dartigues JF, Mayeux R, Tzourio C, Hofman A, Nothen MM, Graff C, Psaty BM, Jones L, Haines JL, Holmans PA, Lathrop M, Pericak-Vance MA, Launer LJ, Farrer LA, van Duijn CM, Van Broeckhoven C, Moskvina V, Seshadri S, Williams J, Schellenberg
Journal Nat. Genet. 45 (12), 1452-1458 (2013)
Title p62/sequestosome-1 up-regulation promotes ABT-263-induced caspase-8 aggregation/activation on the autophagosome .
Author Huang S, Okamoto K, Yu C and Sinicrope FA.
Journal J. Biol. Chem. 288 (47), 33654-33666 (2013)
Title A p56(lck) ligand serves as a coactivator of an orphan nuclear hormone receptor .
Author Marcus SL, Winrow CJ, Capone JP and Rachubinski RA.
Journal J. Biol. Chem. 271 (44), 27197-27200 (1996)
Title p62, a phosphotyrosine-independent ligand of the SH2 domain of p56lck, belongs to a new class of ubiquitin-binding proteins .
Author Vadlamudi RK, Joung I, Strominger JL and Shin J.
Journal J. Biol. Chem. 271 (34), 20235-20237 (1996)
Title Molecular cloning of a phosphotyrosine-independent ligand of the p56lck SH2 domain .
Author Joung I, Strominger JL and Shin J.
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (12), 5991-5995 (1996)
Title A novel interleukin-12 p40-related protein induced by latent Epstein-Barr virus infection in B lymphocytes .
Author Devergne O, Hummel M, Koeppen H, Le Beau MM, Nathanson EC, Kieff E and Birkenbach M.
Journal J. Virol. 70 (2), 1143-1153 (1996)
Title Phosphotyrosine-independent binding of a 62-kDa protein to the src homology 2 (SH2) domain of p56lck and its regulation by phosphorylation of Ser-59 in the lck unique N-terminal region .
Author Park I, Chung J, Walsh CT, Yun Y, Strominger JL and Shin J.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (26), 12338-12342 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.