• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens sequestosome 1 (SQSTM1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003900 Homo sapiens sequestosome 1 (SQSTM1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_003900.4, 188497651
Length 2923 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens sequestosome 1 (SQSTM1), transcript variant 1, mRNA.
Product sequestosome-1 isoform 1
Comment

Summary: This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Alternatively spliced transcript variants encoding either the same or different isoforms have been identified for this gene. Mutations in this gene result in sporadic and familial Paget disease of bone. [provided by RefSeq, Mar 2009].


Transcript Variant: This variant (1) represents the predominant transcript, and encodes the longer isoform (1).

RefSeq NP_003891.1
CDS 96..1418
Misc Feature(1)96..245
Misc Feature(2)96..245
Misc Feature(3)105..401
Misc Feature(4)177..179
Misc Feature(5)222..416
Misc Feature(6)243..335
Misc Feature(7)360..362
Misc Feature(8)459..767
Misc Feature(9)471..599
Misc Feature(10)order(477..479,486..488,519..521,528..530,546..548,
Misc Feature(11)order(477..479,486..488,546..548,555..557)
Misc Feature(12)order(480..482,510..512,516..518,534..536,540..542)
Misc Feature(13)order(513..515,588..590,597..599)
Misc Feature(14)order(519..521,528..530,573..575,582..584)
Misc Feature(15)537..539
Misc Feature(16)603..755
Misc Feature(17)603..605
Misc Feature(18)633..635
Misc Feature(19)639..641
Misc Feature(20)714..716
Misc Feature(21)777..794
Misc Feature(22)840..842
Misc Feature(23)891..893
Misc Feature(24)891..893
Misc Feature(25)900..1415
Misc Feature(26)900..902
Misc Feature(27)900..902
Misc Feature(28)900..902
Misc Feature(29)909..911
Misc Feature(30)909..911
Misc Feature(31)909..911
Misc Feature(32)918..920
Misc Feature(33)921..923
Misc Feature(34)924..926
Misc Feature(35)927..929
Misc Feature(36)939..941
Misc Feature(37)942..944
Misc Feature(38)945..947
Misc Feature(39)1047..1049
Misc Feature(40)1056..1121
Misc Feature(41)1077..1079
Misc Feature(42)1077..1079
Misc Feature(43)1089..1091
Misc Feature(44)1089..1091
Misc Feature(45)1110..1112
Misc Feature(46)1119..1121
Misc Feature(47)1122..1124
Misc Feature(48)1158..1160
Misc Feature(49)1176..1178
Misc Feature(50)1188..1190
Misc Feature(51)1191..1193
Misc Feature(52)1191..1193
Misc Feature(53)1203..1205
Misc Feature(54)1218..1220
Misc Feature(55)1275..1388
Exon (1)1..300
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Exon (2)301..396
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Exon (3)397..626
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Exon (4)627..768
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Exon (5)769..849
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Exon (6)850..1064
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Exon (7)1065..1260
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Exon (8)1261..2903
Gene:SQSTM1
Gene Synonym:A170; OSIL; p60; p62; p62B; PDB3; ZIP3
Translation MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRP GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFS HSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNV GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNV EGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPE SEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK NYDIGAALDTIQYSKHPPPL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
61+dbSNP:
61+c, gdbSNP:189132632
71+a, gdbSNP:74523483
145+c, tdbSNP:141502868
193+c, tdbSNP:200396166
227+c, tdbSNP:11548639
310+dbSNP:
310+c, gdbSNP:11548643
335+c, tdbSNP:148366738
362+c, tdbSNP:150883783
363+a, gdbSNP:181263868
391+c, tdbSNP:11548641
398+dbSNP:
398+c, gdbSNP:11548637
423+c, tdbSNP:139372286
431+a, gdbSNP:144289539
445+c, tdbSNP:147810437
447+c, tdbSNP:200152247
467+a, c, tdbSNP:11548640
525+a, gdbSNP:200973006
551+c, tdbSNP:145037913
552+a, gdbSNP:145056421
569+a, gdbSNP:35266480
577+a, g, tdbSNP:118160361
608+c, gdbSNP:199931327
612+a, gdbSNP:200731802
637+dbSNP:
637+a, c, tdbSNP:113956324
674+a, gdbSNP:527602
677+c, gdbSNP:11548634
687+c, tdbSNP:11548635
729+c, tdbSNP:201263163
757+c, tdbSNP:199663339
769+dbSNP:
769+c, tdbSNP:202235745
778+c, tdbSNP:151191977
782+a, gdbSNP:140341924
791+a, gdbSNP:145688323
807+a, gdbSNP:11548633
814+c, tdbSNP:142719499
858+dbSNP:
858+c, gdbSNP:182522590
878+c, tdbSNP:145001811
884+a, gdbSNP:200889080
894+c, tdbSNP:138928957
895+a, gdbSNP:149424705
901+c, tdbSNP:185313167
914+a, gdbSNP:200388590
917+c, gdbSNP:55793208
919+a, gdbSNP:201923000
922+a, cdbSNP:202119215
928+c, tdbSNP:200445838
942+a, gdbSNP:148559402
971+c, tdbSNP:4935
983+a, gdbSNP:148984239
992+a, tdbSNP:139575774
1001+c, tdbSNP:11548642
1003+c, tdbSNP:143746604
1006+c, tdbSNP:150926394
1019+a, gdbSNP:139482113
1029+a, gdbSNP:149743469
1031+a, gdbSNP:4797
1037+c, tdbSNP:200695664
1041+c, tdbSNP:140315612
1049+c, tdbSNP:56092424
1050+a, gdbSNP:61748794
1056+c, tdbSNP:140226523
1079+dbSNP:
1079+a, gdbSNP:146164139
1081+a, gdbSNP:148294622
1091+a, gdbSNP:141436407
1133+a, gdbSNP:150470670
1139+a, gdbSNP:10058037
1178+c, tdbSNP:201591177
1203+c, tdbSNP:143956614
1224+c, gdbSNP:147305175
1270+dbSNP:
1270+c, tdbSNP:104893941
1271+a, gdbSNP:75700262
1273+a, gdbSNP:200551825
1296+a, cdbSNP:201795943
1326+a, gdbSNP:143511494
1340+a, gdbSNP:148278350
1372+c, tdbSNP:201239306
1373+a, gdbSNP:143977783
1409+a, gdbSNP:182058393
1411+c, tdbSNP:199854262
1412+g, tdbSNP:11548636
1432..1446+, cctcttctgcgtgccdbSNP:138527258
1484+a, cdbSNP:140407570
1500+a, gdbSNP:11548622
1501+c, tdbSNP:155790
1532+, gdbSNP:71657472
1592..1593+, tgdbSNP:35481022
1593..1594+, tgdbSNP:71703989
1593+g, tdbSNP:186996560
1594..1595+, gtdbSNP:71714822
1606..1607+, tgdbSNP:10688915
1610+c, tdbSNP:11249660
1629+c, tdbSNP:17409649
1632+g, tdbSNP:17409643
1676+c, tdbSNP:117531194
1697+c, gdbSNP:11548631
1737+c, tdbSNP:11548630
1805+a, gdbSNP:188873621
1806+c, tdbSNP:181341443
1814+g, tdbSNP:150371553
1921+c, tdbSNP:10027
1923+c, tdbSNP:138055371
1924+a, gdbSNP:185559724
1957..1958+g, tdbSNP:11548632
1957+a, cdbSNP:1060271
1959..1960+c, tdbSNP:11548621
1959+c, tdbSNP:14800
1961..1962+c, tdbSNP:11548625
1978+c, tdbSNP:14799
1979..1980+c, tdbSNP:11548627
1983..1984+c, tdbSNP:11548624
2009+c, tdbSNP:11548623
2010+a, gdbSNP:11548620
2031+c, tdbSNP:11548626
2039+c, tdbSNP:11548628
2042+c, tdbSNP:11548619
2051+c, tdbSNP:10173
2070+a, c, tdbSNP:14801
2080+a, tdbSNP:112765500
2085+a, tdbSNP:190193171
2128+c, gdbSNP:149508576
2141..2142+, tcttdbSNP:144467418
2204+a, gdbSNP:73334055
2255+a, gdbSNP:148611524
2266+a, gdbSNP:142061446
2274+c, tdbSNP:150786805
2291+c, tdbSNP:139424223
2371+g, tdbSNP:11548638
2378+a, gdbSNP:144080871
2405+a, gdbSNP:199727564
2440+a, gdbSNP:146092066
2458+c, gdbSNP:116069534
2491+c, tdbSNP:61746305
2507+c, tdbSNP:200300835
2519+a, gdbSNP:61742526
2529+c, gdbSNP:199887787
2556+c, tdbSNP:10277
2559+a, gdbSNP:143664576
2615+a, gdbSNP:138523364
2711+c, gdbSNP:201824663
2740+a, cdbSNP:1065154
2754+c, tdbSNP:199862884
2812+c, tdbSNP:182968597
Gene SymbolSQSTM1
Gene SynonymA170; OSIL; p60; p62; p62B; PDB3; ZIP3
Chromosome5
Locus Map5q35
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001142298 Homo sapiens sequestosome 1 (SQSTM1), transcript variant 2, mRNA. On-demand $549.00 14
NM_001142299 Homo sapiens sequestosome 1 (SQSTM1), transcript variant 3, mRNA. On-demand $549.00 14
NM_003900 Homo sapiens sequestosome 1 (SQSTM1), transcript variant 1, mRNA. On-demand $699.00 18
Title Autophagy negatively regulates cancer cell proliferation via selectively targeting VPRBP .
Author Wang,B.S., Liu,Y.Z., Yang,Y., Zhang,Y., Hao,J.J., Yang,H., Wang,X.M., Zhang,Z.Q., Zhan,Q.M. and Wang,M.R.
Journal Clin. Sci. 124 (3), 203-214 (2013)
Title Mutations in the gene encoding p62 in Japanese patients with amyotrophic lateral sclerosis .
Author Hirano,M., Nakamura,Y., Saigoh,K., Sakamoto,H., Ueno,S., Isono,C., Miyamoto,K., Akamatsu,M., Mitsui,Y. and Kusunoki,S.
Journal Neurology 80 (5), 458-463 (2013)
Title p62 binding to protein kinase C zeta regulates tumor necrosis factor alpha-induced apoptotic pathway in endothelial cells .
Author Kim,G.Y., Nigro,P., Fujiwara,K., Abe,J. and Berk,B.C.
Journal Arterioscler. Thromb. Vasc. Biol. 32 (12), 2974-2980 (2012)
Title SQSTM1 mutations in frontotemporal lobar degeneration and amyotrophic lateral sclerosis .
Author Rubino,E., Rainero,I., Chio,A., Rogaeva,E., Galimberti,D., Fenoglio,P., Grinberg,Y., Isaia,G., Calvo,A., Gentile,S., Bruni,A.C., St George-Hyslop,P.H., Scarpini,E., Gallone,S. and Pinessi,L.
Journal Neurology 79 (15), 1556-1562 (2012)
Title Tissue specific induction of p62/Sqstm1 by farnesoid X receptor .
Author Williams,J.A., Thomas,A.M., Li,G., Kong,B., Zhan,L., Inaba,Y., Xie,W., Ding,W.X. and Guo,G.L.
Journal PLoS ONE 7 (8), E43961 (2012)
Title A p56(lck) ligand serves as a coactivator of an orphan nuclear hormone receptor .
Author Marcus,S.L., Winrow,C.J., Capone,J.P. and Rachubinski,R.A.
Journal J. Biol. Chem. 271 (44), 27197-27200 (1996)
Title p62, a phosphotyrosine-independent ligand of the SH2 domain of p56lck, belongs to a new class of ubiquitin-binding proteins .
Author Vadlamudi,R.K., Joung,I., Strominger,J.L. and Shin,J.
Journal J. Biol. Chem. 271 (34), 20235-20237 (1996)
Title Molecular cloning of a phosphotyrosine-independent ligand of the p56lck SH2 domain .
Author Joung,I., Strominger,J.L. and Shin,J.
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (12), 5991-5995 (1996)
Title A novel interleukin-12 p40-related protein induced by latent Epstein-Barr virus infection in B lymphocytes .
Author Devergne,O., Hummel,M., Koeppen,H., Le Beau,M.M., Nathanson,E.C., Kieff,E. and Birkenbach,M.
Journal J. Virol. 70 (2), 1143-1153 (1996)
Title Phosphotyrosine-independent binding of a 62-kDa protein to the src homology 2 (SH2) domain of p56lck and its regulation by phosphorylation of Ser-59 in the lck unique N-terminal region .
Author Park,I., Chung,J., Walsh,C.T., Yun,Y., Strominger,J.L. and Shin,J.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (26), 12338-12342 (1995)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.