Homo sapiens cyclin A1 (CCNA1), transcript variant 1, mRNA.
| RefSeq Version | NM_003914.3, 161377466 |
| Length | 1965 bp |
| Structure | linear |
| Update Date | 12-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens cyclin A1 (CCNA1), transcript variant 1, mRNA. |
| Product | cyclin-A1 isoform a |
| Comment | Summary: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. The cyclin encoded by this gene was shown to be expressed in testis and brain, as well as in several leukemic cell lines, and is thought to primarily function in the control of the germline meiotic cell cycle. This cyclin binds both CDK2 and CDC2 kinases, which give two distinct kinase activities, one appearing in S phase, the other in G2, and thus regulate separate functions in cell cycle. This cyclin was found to bind to important cell cycle regulators, such as Rb family proteins, transcription factor E2F-1, and the p21 family proteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (a). |
| RefSeq | NP_003905.1 |
| CDS | 351..1748 | Exon (1) | 1..458 | Exon (2) | 1..458 | Exon (3) | 459..647 | Exon (4) | 648..894 | Exon (5) | 895..1019 | Exon (6) | 1020..1243 | Exon (7) | 1244..1448 | Exon (8) | 1449..1562 | Exon (9) | 1563..1696 | Exon (10) | 1697..1965 |
| Translation | METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVA
RGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKK
ALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFN
TVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDIT
EGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKY
EEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVR
TENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIV
PCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 55 | + | c, g | dbSNP:7985423 |
| 174 | + | g, t | dbSNP:11839265 |
| 327 | + | a, g | dbSNP:75259848 |
| 429 | + | a, g | dbSNP:113565588 |
| 574 | + | , g | dbSNP:67527817 |
| 671 | + | c, t | dbSNP:61729896 |
| 775 | + | a, t | dbSNP:61733784 |
| 817 | + | c, t | dbSNP:113260257 |
| 954 | + | g, t | dbSNP:111296887 |
| 959 | + | a, g | dbSNP:35404413 |
| 1070 | + | a, g | dbSNP:61755283 |
| 1105 | + | g, t | dbSNP:78810484 |
| 1108 | + | a, g | dbSNP:79164354 |
| 1117 | + | a, g | dbSNP:117905206 |
| 1383 | + | a, g | dbSNP:61755282 |
| 1444 | + | a, c | dbSNP:35918374 |
| 1758..1759 | + | , g | dbSNP:35916714 |
| Gene Symbol | CCNA1 |
| Gene Synonym | CCNA1 |
| Chromosome | 13 |
| Locus Map | 13q12.3-q13 |
| All Transcripts | NM_003914 , NM_001111047 , NM_001111045 , NM_001111046 |
| Title | IRE1alpha controls cyclin A1 expression and promotes cell proliferation through XBP-1 . |
| Author | Thorpe,J.A. and Schwarze,S.R. |
| Journal | Cell Stress Chaperones 15 (5), 497-508 (2010) |
| Title | KDM8, a H3K36me2 histone demethylase that acts in the cyclin A1 coding region to regulate cancer cell proliferation . |
| Author | Hsia,D.A., Tepper,C.G., Pochampalli,M.R., Hsia,E.Y., Izumiya,C., Huerta,S.B., Wright,M.E., Chen,H.W., Kung,H.J. and Izumiya,Y. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 107 (21), 9671-9676 (2010) |
| Title | Role of human immunodeficiency virus type 1 integrase in uncoating of the viral core . |
| Author | Briones,M.S., Dobard,C.W. and Chow,S.A. |
| Journal | J. Virol. 84 (10), 5181-5190 (2010) |
| Title | Methylation markers for CCNA1 and C13ORF18 are strongly associated with high-grade cervical intraepithelial neoplasia and cervical cancer in cervical scrapings . |
| Author | Yang,N., Eijsink,J.J., Lendvai,A., Volders,H.H., Klip,H., Buikema,H.J., van Hemel,B.M., Schuuring,E., van der Zee,A.G. and Wisman,G.B. |
| Journal | Cancer Epidemiol. Biomarkers Prev. 18 (11), 3000-3007 (2009) |
| Title | Mutations of the cyclin A1 gene are not a common cause of male infertility . |
| Author | Zhoucun,A., Zhang,S. and Yang,Y. |
| Journal | Syst Biol Reprod Med 55 (4), 125-128 (2009) |
| Title | BRCA1 proteins are transported to the nucleus in the absence of serum and splice variants BRCA1a, BRCA1b are tyrosine phosphoproteins that associate with E2F, cyclins and cyclin dependent kinases . |
| Author | Wang,H., Shao,N., Ding,Q.M., Cui,J., Reddy,E.S. and Rao,V.N. |
| Journal | Oncogene 15 (2), 143-157 (1997) |
| Title | Characterization of a second human cyclin A that is highly expressed in testis and in several leukemic cell lines . |
| Author | Yang,R., Morosetti,R. and Koeffler,H.P. |
| Journal | Cancer Res. 57 (5), 913-920 (1997) |
| Title | A distinct cyclin A is expressed in germ cells in the mouse . |
| Author | Sweeney,C., Murphy,M., Kubelka,M., Ravnik,S.E., Hawkins,C.F., Wolgemuth,D.J. and Carrington,M. |
| Journal | Development 122 (1), 53-64 (1996) |
| Title | Evidence for different modes of action of cyclin-dependent kinase inhibitors: p15 and p16 bind to kinases, p21 and p27 bind to cyclins . |
| Author | Hall,M., Bates,S. and Peters,G. |
| Journal | Oncogene 11 (8), 1581-1588 (1995) |
| Title | Cyclin A/CDK2 binds directly to E2F-1 and inhibits the DNA-binding activity of E2F-1/DP-1 by phosphorylation . |
| Author | Xu,M., Sheppard,K.A., Peng,C.Y., Yee,A.S. and Piwnica-Worms,H. |
| Journal | Mol. Cell. Biol. 14 (12), 8420-8431 (1994) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |