• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cyclin A1 (CCNA1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003914 Homo sapiens cyclin A1 (CCNA1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_003914.3, 161377466
Length 1965 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens cyclin A1 (CCNA1), transcript variant 1, mRNA.
Product cyclin-A1 isoform a
Comment

Summary: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. The cyclin encoded by this gene was shown to be expressed in testis and brain, as well as in several leukemic cell lines, and is thought to primarily function in the control of the germline meiotic cell cycle. This cyclin binds both CDK2 and CDC2 kinases, which give two distinct kinase activities, one appearing in S phase, the other in G2, and thus regulate separate functions in cell cycle. This cyclin was found to bind to important cell cycle regulators, such as Rb family proteins, transcription factor E2F-1, and the p21 family proteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (a).

RefSeq NP_003905.1
CDS 351..1748
Misc Feature(1)240..242
Misc Feature(2)1077..1304
Misc Feature(3)1077..1304
Misc Feature(4)order(1077..1082,1098..1103,1107..1112,1176..1178,
Misc Feature(5)order(1233..1235,1245..1247,1269..1271)
Misc Feature(6)1368..1631
Misc Feature(7)order(1368..1373,1389..1394,1398..1403,1467..1469,
Misc Feature(8)order(1527..1529,1539..1541,1560..1562,1605..1607,
Exon (1)1..458
Gene:CCNA1
Gene Synonym:CCNA1
Exon (2)459..647
Gene:CCNA1
Gene Synonym:CCNA1
Exon (3)648..894
Gene:CCNA1
Gene Synonym:CCNA1
Exon (4)895..1019
Gene:CCNA1
Gene Synonym:CCNA1
Exon (5)1020..1243
Gene:CCNA1
Gene Synonym:CCNA1
Exon (6)1244..1448
Gene:CCNA1
Gene Synonym:CCNA1
Exon (7)1449..1562
Gene:CCNA1
Gene Synonym:CCNA1
Exon (8)1563..1696
Gene:CCNA1
Gene Synonym:CCNA1
Exon (9)1697..1965
Gene:CCNA1
Gene Synonym:CCNA1
Translation METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVA RGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKK ALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFN TVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDIT EGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKY EEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVR TENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIV PCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
55+dbSNP:
55+c, gdbSNP:7985423
174+g, tdbSNP:11839265
327+a, gdbSNP:75259848
373+a, tdbSNP:201966146
408+a, gdbSNP:139574122
429+a, gdbSNP:113565588
437+a, gdbSNP:140980274
464+dbSNP:
464+c, gdbSNP:141476503
488+c, tdbSNP:147007878
499+c, tdbSNP:142133640
500+c, tdbSNP:151081377
505+a, gdbSNP:145220476
539+c, tdbSNP:149125997
561+a, gdbSNP:143296005
572+, gdbSNP:67527817
593+a, gdbSNP:201226091
599+a, gdbSNP:148316727
671+c, tdbSNP:61729896
713+a, gdbSNP:145829125
775+a, tdbSNP:61733784
802+c, tdbSNP:143100244
817+c, tdbSNP:113260257
825+a, gdbSNP:199835821
848+c, tdbSNP:146151574
866+c, tdbSNP:201364984
889+a, gdbSNP:200724447
954+dbSNP:
954+g, tdbSNP:111296887
958+c, tdbSNP:139038414
959+a, gdbSNP:35404413
1024+dbSNP:
1024+a, gdbSNP:143960265
1070+a, gdbSNP:61755283
1102..1103+, gdbSNP:140782401
1105+g, tdbSNP:78810484
1108+a, gdbSNP:200577481
1117+c, tdbSNP:202149829
1154+c, tdbSNP:144283302
1157+c, gdbSNP:183736861
1214+c, tdbSNP:147834946
1241+a, tdbSNP:150705387
1243+c, tdbSNP:145298804
1295+dbSNP:
1295+c, tdbSNP:150999500
1315+a, gdbSNP:140946240
1383+a, gdbSNP:61755282
1385+a, cdbSNP:199981149
1444+a, cdbSNP:35918374
1494+dbSNP:
1494+c, tdbSNP:145699331
1505+a, gdbSNP:180874885
1508+a, gdbSNP:146743791
1621+dbSNP:
1621+c, gdbSNP:140628294
1636+c, tdbSNP:145685321
1652+c, tdbSNP:138448439
1735+dbSNP:
1735+c, tdbSNP:199986257
1758..1759+, gdbSNP:35916714
1797+c, tdbSNP:183429673
Gene SymbolCCNA1
Gene SynonymCCNA1
Chromosome13
Locus Map13q12.3-q13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001111045 Homo sapiens cyclin A1 (CCNA1), transcript variant 2, mRNA. In-stock $509.00 $460.00 12
NM_001111046 Homo sapiens cyclin A1 (CCNA1), transcript variant 3, mRNA. In-stock $509.00 $460.00 12
NM_001111047 Homo sapiens cyclin A1 (CCNA1), transcript variant 4, mRNA. In-stock $509.00 $460.00 12
NM_003914 Homo sapiens cyclin A1 (CCNA1), transcript variant 1, mRNA. On-demand $699.00 18
Title Foxo3a drives proliferation in anaplastic thyroid carcinoma through transcriptional regulation of cyclin A1: a paradigm shift that impacts current therapeutic strategies .
Author Marlow,L.A., von Roemeling,C.A., Cooper,S.J., Zhang,Y., Rohl,S.D., Arora,S., Gonzales,I.M., Azorsa,D.O., Reddi,H.V., Tun,H.W., Doppler,H.R., Storz,P., Smallridge,R.C. and Copland,J.A.
Journal J. Cell. Sci. 125 (PT 18), 4253-4263 (2012)
Title Cyclin-A1 represents a new immunogenic targetable antigen expressed in acute myeloid leukemia stem cells with characteristics of a cancer-testis antigen .
Author Ochsenreither,S., Majeti,R., Schmitt,T., Stirewalt,D., Keilholz,U., Loeb,K.R., Wood,B., Choi,Y.E., Bleakley,M., Warren,E.H., Hudecek,M., Akatsuka,Y., Weissman,I.L. and Greenberg,P.D.
Journal Blood 119 (23), 5492-5501 (2012)
Title Inverse relationship between TCTP/RhoA and p53 /cyclin A/actin expression in ovarian cancer cells .
Author Kloc,M., Tejpal,N., Sidhu,J., Ganachari,M., Flores-Villanueva,P., Jennings,N.B., Sood,A.K., Kubiak,J.Z. and Ghobrial,R.M.
Journal Folia Histochem. Cytobiol. 50 (3), 358-367 (2012)
Title Expression of cyclins A and E in melanocytic skin lesions and its correlation with some clinicopathologic features .
Author Alekseenko,A., Wojas-Pelc,A., Lis,G.J., Wisniowski,Z., Czerwinska,M., Niewiara,L. and Litwin,J.A.
Journal Folia Histochem. Cytobiol. 50 (2), 263-269 (2012)
Title Cyclin A1 shows age-related expression in benign tonsils, HPV16-dependent overexpression in HNSCC and predicts lower recurrence rate in HNSCC independently of HPV16 .
Author Weiss,D., Koopmann,M., Basel,T. and Rudack,C.
Journal BMC Cancer 12, 259 (2012)
Title Characterization of a second human cyclin A that is highly expressed in testis and in several leukemic cell lines .
Author Yang,R., Morosetti,R. and Koeffler,H.P.
Journal Cancer Res. 57 (5), 913-920 (1997)
Title Cyclin-binding motifs are essential for the function of p21CIP1 .
Author Chen,J., Saha,P., Kornbluth,S., Dynlacht,B.D. and Dutta,A.
Journal Mol. Cell. Biol. 16 (9), 4673-4682 (1996)
Title A distinct cyclin A is expressed in germ cells in the mouse .
Author Sweeney,C., Murphy,M., Kubelka,M., Ravnik,S.E., Hawkins,C.F., Wolgemuth,D.J. and Carrington,M.
Journal Development 122 (1), 53-64 (1996)
Title Evidence for different modes of action of cyclin-dependent kinase inhibitors: p15 and p16 bind to kinases, p21 and p27 bind to cyclins .
Author Hall,M., Bates,S. and Peters,G.
Journal Oncogene 11 (8), 1581-1588 (1995)
Title Cyclin A/CDK2 binds directly to E2F-1 and inhibits the DNA-binding activity of E2F-1/DP-1 by phosphorylation .
Author Xu,M., Sheppard,K.A., Peng,C.Y., Yee,A.S. and Piwnica-Worms,H.
Journal Mol. Cell. Biol. 14 (12), 8420-8431 (1994)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.