• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cyclin A1 (CCNA1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_003914 Homo sapiens cyclin A1 (CCNA1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_003914.3, 161377466
Length 1965 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens cyclin A1 (CCNA1), transcript variant 1, mRNA.
Product cyclin-A1 isoform a
Comment

Summary: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. The cyclin encoded by this gene was shown to be expressed in testis and brain, as well as in several leukemic cell lines, and is thought to primarily function in the control of the germline meiotic cell cycle. This cyclin binds both CDK2 and CDC2 kinases, which give two distinct kinase activities, one appearing in S phase, the other in G2, and thus regulate separate functions in cell cycle. This cyclin was found to bind to important cell cycle regulators, such as Rb family proteins, transcription factor E2F-1, and the p21 family proteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (a).

RefSeq NP_003905.1
CDS 351..1748
Misc Feature(1)240..242
Misc Feature(2)1077..1346
Misc Feature(3)1077..1346
Misc Feature(4)order(1077..1082,1098..1103,1107..1112,1176..1178,
Misc Feature(5)order(1233..1235,1245..1247,1269..1271,1320..1322,
Misc Feature(6)1368..1631
Misc Feature(7)order(1368..1373,1389..1394,1398..1403,1467..1469,
Misc Feature(8)order(1527..1529,1539..1541,1560..1562,1605..1607,
Exon (1)1..458
Gene:CCNA1
Gene Synonym:CT146
Exon (2)459..647
Gene:CCNA1
Gene Synonym:CT146
Exon (3)648..894
Gene:CCNA1
Gene Synonym:CT146
Exon (4)895..1019
Gene:CCNA1
Gene Synonym:CT146
Exon (5)1020..1243
Gene:CCNA1
Gene Synonym:CT146
Exon (6)1244..1448
Gene:CCNA1
Gene Synonym:CT146
Exon (7)1449..1562
Gene:CCNA1
Gene Synonym:CT146
Exon (8)1563..1696
Gene:CCNA1
Gene Synonym:CT146
Exon (9)1697..1965
Gene:CCNA1
Gene Synonym:CT146
Translation METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVA RGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKK ALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFN TVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDIT EGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKY EEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVR TENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIV PCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
55+dbSNP:
55+c, gdbSNP:7985423
66+c, tdbSNP:375639175
174+g, tdbSNP:11839265
308+a, gdbSNP:370767056
327+a, gdbSNP:75259848
340+c, gdbSNP:373951116
373+a, tdbSNP:201966146
408+a, gdbSNP:139574122
429+a, gdbSNP:113565588
430+a, gdbSNP:376028215
437+a, gdbSNP:140980274
464+dbSNP:
464+c, gdbSNP:141476503
488+c, tdbSNP:147007878
494+c, tdbSNP:377589059
499+c, tdbSNP:142133640
500+c, tdbSNP:151081377
505+a, gdbSNP:145220476
522+a, gdbSNP:370964964
539+c, tdbSNP:149125997
552+a, tdbSNP:368007173
561+a, gdbSNP:143296005
567+c, gdbSNP:370590641
593+a, gdbSNP:201226091
599+a, gdbSNP:148316727
671+c, tdbSNP:61729896
713+a, gdbSNP:145829125
739+c, gdbSNP:367588569
775+a, tdbSNP:61733784
783+a, gdbSNP:371431411
802+c, tdbSNP:143100244
803+a, gdbSNP:368505689
817+c, tdbSNP:113260257
825+a, gdbSNP:199835821
832+a, tdbSNP:374907767
858+a, gdbSNP:368185225
866+c, tdbSNP:201364984
889+a, gdbSNP:200724447
912+dbSNP:
912+g, tdbSNP:373472360
926+c, tdbSNP:373454867
954+g, tdbSNP:111296887
958+c, tdbSNP:139038414
959+a, gdbSNP:35404413
1024+dbSNP:
1024+a, gdbSNP:143960265
1059+c, tdbSNP:376677628
1070+a, gdbSNP:61755283
1102..1103+, gdbSNP:140782401
1105+g, tdbSNP:78810484
1108+a, gdbSNP:200577481
1117+c, tdbSNP:202149829
1127+a, cdbSNP:369651921
1131+c, tdbSNP:267603811
1154+c, tdbSNP:144283302
1157+c, gdbSNP:183736861
1214+c, tdbSNP:147834946
1241+a, tdbSNP:150705387
1243+c, tdbSNP:145298804
1257+dbSNP:
1257+a, tdbSNP:370143844
1295+c, tdbSNP:150999500
1310+a, cdbSNP:372575050
1314+c, tdbSNP:373856311
1315+a, gdbSNP:140946240
1383+a, gdbSNP:61755282
1385+a, cdbSNP:199981149
1411+a, gdbSNP:267603812
1444+a, cdbSNP:35918374
1494+dbSNP:
1494+c, tdbSNP:145699331
1505+a, gdbSNP:180874885
1507+g, tdbSNP:369777099
1508+a, gdbSNP:146743791
1621+dbSNP:
1621+c, gdbSNP:140628294
1636+c, tdbSNP:145685321
1652+c, tdbSNP:138448439
1710+dbSNP:
1710+a, tdbSNP:374549136
1735+c, tdbSNP:199986257
1745+a, gdbSNP:375639121
1758..1759+, gdbSNP:35916714
1770+c, tdbSNP:370199906
1797+c, tdbSNP:183429673
Gene SymbolCCNA1
Gene SynonymCT146
Chromosome13
Locus Map13q12.3-q13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001111046 Homo sapiens cyclin A1 (CCNA1), transcript variant 3, mRNA. In-stock $509.00 $460.00 12
NM_003914 Homo sapiens cyclin A1 (CCNA1), transcript variant 1, mRNA. On-demand $699.00 18
NM_001111045 Homo sapiens cyclin A1 (CCNA1), transcript variant 2, mRNA. In-stock $509.00 $460.00 12
NM_001111047 Homo sapiens cyclin A1 (CCNA1), transcript variant 4, mRNA. In-stock $509.00 $460.00 12
Title Altered expression of cyclin A 1 in muscle of patients with facioscapulohumeral muscle dystrophy (FSHD-1) .
Author Pakula A, Schneider J, Janke J, Zacharias U, Schulz H, Hubner N, Mahler A, Spuler A, Spuler S, Carlier P and Boschmann M.
Journal PLoS ONE 8 (9), E73573 (2013)
Title Cyclin A1 modulates the expression of vascular endothelial growth factor and promotes hormone-dependent growth and angiogenesis of breast cancer .
Author Syed Khaja AS, Dizeyi N, Kopparapu PK, Anagnostaki L, Harkonen P and Persson JL.
Journal PLoS ONE 8 (8), E72210 (2013)
Title Foxo3a drives proliferation in anaplastic thyroid carcinoma through transcriptional regulation of cyclin A1: a paradigm shift that impacts current therapeutic strategies .
Author Marlow LA, von Roemeling CA, Cooper SJ, Zhang Y, Rohl SD, Arora S, Gonzales IM, Azorsa DO, Reddi HV, Tun HW, Doppler HR, Storz P, Smallridge RC and Copland JA.
Journal J. Cell. Sci. 125 (PT 18), 4253-4263 (2012)
Title Inverse relationship between TCTP/RhoA and p53 /cyclin A/actin expression in ovarian cancer cells .
Author Kloc M, Tejpal N, Sidhu J, Ganachari M, Flores-Villanueva P, Jennings NB, Sood AK, Kubiak JZ and Ghobrial RM.
Journal Folia Histochem. Cytobiol. 50 (3), 358-367 (2012)
Title Expression of cyclins A and E in melanocytic skin lesions and its correlation with some clinicopathologic features .
Author Alekseenko A, Wojas-Pelc A, Lis GJ, Wisniowski Z, Czerwinska M, Niewiara L and Litwin JA.
Journal Folia Histochem. Cytobiol. 50 (2), 263-269 (2012)
Title Characterization of a second human cyclin A that is highly expressed in testis and in several leukemic cell lines .
Author Yang R, Morosetti R and Koeffler HP.
Journal Cancer Res. 57 (5), 913-920 (1997)
Title Cyclin-binding motifs are essential for the function of p21CIP1 .
Author Chen J, Saha P, Kornbluth S, Dynlacht BD and Dutta A.
Journal Mol. Cell. Biol. 16 (9), 4673-4682 (1996)
Title A distinct cyclin A is expressed in germ cells in the mouse .
Author Sweeney C, Murphy M, Kubelka M, Ravnik SE, Hawkins CF, Wolgemuth DJ and Carrington M.
Journal Development 122 (1), 53-64 (1996)
Title Evidence for different modes of action of cyclin-dependent kinase inhibitors: p15 and p16 bind to kinases, p21 and p27 bind to cyclins .
Author Hall M, Bates S and Peters G.
Journal Oncogene 11 (8), 1581-1588 (1995)
Title Cyclin A/CDK2 binds directly to E2F-1 and inhibits the DNA-binding activity of E2F-1/DP-1 by phosphorylation .
Author Xu M, Sheppard KA, Peng CY, Yee AS and Piwnica-Worms H.
Journal Mol. Cell. Biol. 14 (12), 8420-8431 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.