• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cyclin-dependent kinase inhibitor 1B (p27, Kip1) (CDKN1B), mRNA.


RefSeq Accession Definition Services Price Order
NM_004064 Homo sapiens cyclin-dependent kinase inhibitor 1B (p27, Kip1) (CDKN1B), mRNA. ORF Sequence $173.13
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_004064.3, 207113192
Length 2413 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens cyclin-dependent kinase inhibitor 1B (p27, Kip1) (CDKN1B), mRNA.
Product cyclin-dependent kinase inhibitor 1B
Comment

Summary: This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. [provided by RefSeq, Jul 2008].

RefSeq NP_004055.1
CDS 473..1069
Misc Feature(1)398..400
Misc Feature(2)500..502
Misc Feature(3)500..502
Misc Feature(4)500..502
Misc Feature(5)560..712
Misc Feature(6)692..694
Misc Feature(7)692..694
Misc Feature(8)692..694
Misc Feature(9)734..736
Misc Feature(10)734..736
Misc Feature(11)734..736
Misc Feature(12)734..736
Misc Feature(13)734..736
Misc Feature(14)737..739
Misc Feature(15)890..892
Misc Feature(16)929..979
Misc Feature(17)941..943
Misc Feature(18)941..943
Misc Feature(19)1031..1033
Misc Feature(20)1031..1033
Misc Feature(21)1031..1033
Misc Feature(22)1064..1066
Misc Feature(23)1064..1066
Exon (1)1..947
Gene:CDKN1B
Gene Synonym:CDKN4; KIP1; MEN1B; MEN4; P27KIP1
Exon (2)948..1077
Gene:CDKN1B
Gene Synonym:CDKN4; KIP1; MEN1B; MEN4; P27KIP1
Exon (3)1078..2413
Gene:CDKN1B
Gene Synonym:CDKN4; KIP1; MEN1B; MEN4; P27KIP1
Translation MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN AGSVEQTPKKPGLRRRQT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
102+dbSNP:
102+c, gdbSNP:11550615
207+c, gdbSNP:3093728
231+c, tdbSNP:191541352
271+c, tdbSNP:183710253
389+c, gdbSNP:115834392
394+c, tdbSNP:34330
464+a, gdbSNP:202167434
515+c, tdbSNP:2066828
526+c, tdbSNP:151027466
571+c, tdbSNP:201349921
586+c, tdbSNP:141178987
597+c, tdbSNP:200422211
637+a, gdbSNP:16908375
640+c, tdbSNP:35456792
649+a, gdbSNP:140927518
697+c, gdbSNP:139727620
699+a, gdbSNP:121917832
730+a, gdbSNP:142940486
748+g, tdbSNP:146161282
749+c, tdbSNP:140167393
752+c, tdbSNP:146217922
755+c, tdbSNP:188579132
756+c, gdbSNP:200141048
798+g, tdbSNP:2066827
817+a, gdbSNP:199570763
828+c, tdbSNP:142833529
834+c, tdbSNP:201685429
837+c, tdbSNP:146973564
869+a, cdbSNP:137985549
898+a, gdbSNP:149775942
915+g, tdbSNP:200476090
936+c, gdbSNP:143879243
943+a, cdbSNP:148621396
990+dbSNP:
990+a, gdbSNP:141509450
1002+c, gdbSNP:146167605
1015+c, gdbSNP:140177202
1049+c, tdbSNP:73281150
1051+c, tdbSNP:201701670
1059+a, gdbSNP:112962540
1076+c, tdbSNP:200321335
1166+dbSNP:
1166+g, tdbSNP:114975362
1250+c, tdbSNP:4251696
1328+c, tdbSNP:79141596
1385+c, tdbSNP:201691620
1404+a, gdbSNP:192945515
1436+a, gdbSNP:1042935
1501+g, tdbSNP:146111672
1522+a, gdbSNP:139019732
1563+c, gdbSNP:183142712
1570+a, gdbSNP:4251697
1679+a, tdbSNP:4251698
1874+c, tdbSNP:1042937
1902+a, tdbSNP:141549130
2025+a, cdbSNP:7330
2061+a, gdbSNP:187299006
2113+a, cdbSNP:10237
2333+a, gdbSNP:192280810
2398+a, tdbSNP:184666485
Gene SymbolCDKN1B
Gene SynonymCDKN4; KIP1; MEN1B; MEN4; P27KIP1
Chromosome12
Locus Map12p13.1-p12
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_004064 Homo sapiens cyclin-dependent kinase inhibitor 1B (p27, Kip1) (CDKN1B), mRNA. Full Length $699.77
ORF Sequence $173.13
Title Early mitotic inhibitor-1, an anaphase-promoting complex/cyclosome inhibitor, can control tumor cell proliferation in hepatocellular carcinoma: correlation with Skp2 stability and degradation of p27(Kip1) .
Author Zhao,Y., Tang,Q., Ni,R., Huang,X., Wang,Y., Lu,C., Shen,A., Wang,Y., Li,C., Yuan,Q., Chen,H., Cheng,C. and He,S.
Journal Hum. Pathol. 44 (3), 365-373 (2013)
Title Oligodendrocyte regeneration after neonatal hypoxia requires FoxO1-mediated p27Kip1 expression .
Author Jablonska,B., Scafidi,J., Aguirre,A., Vaccarino,F., Nguyen,V., Borok,E., Horvath,T.L., Rowitch,D.H. and Gallo,V.
Journal J. Neurosci. 32 (42), 14775-14793 (2012)
Title Cell cycle regulation by the intrinsically disordered proteins p21 and p27 .
Author Yoon,M.K., Mitrea,D.M., Ou,L. and Kriwacki,R.W.
Journal Biochem. Soc. Trans. 40 (5), 981-988 (2012)
Title Oncogenic role of Skp2 and p27Kip1 in intraductal proliferative lesions of the breast .
Author Yan,L., Yun,N., Xiu-Min,D. and Xu-Qi,X.
Journal Chin. Med. Sci. J. 27 (3), 161-166 (2012)
Title Estrogen and progesterone regulate p27kip1 levels via the ubiquitin-proteasome system: pathogenic and therapeutic implications for endometrial cancer .
Author Huang,K.T., Pavlides,S.C., Lecanda,J., Blank,S.V., Mittal,K.R. and Gold,L.I.
Journal PLoS ONE 7 (9), E46072 (2012)
Title Evidence for different modes of action of cyclin-dependent kinase inhibitors: p15 and p16 bind to kinases, p21 and p27 bind to cyclins .
Author Hall,M., Bates,S. and Peters,G.
Journal Oncogene 11 (8), 1581-1588 (1995)
Title p27Kip1: chromosomal mapping to 12p12-12p13.1 and absence of mutations in human tumors .
Author Ponce-Castaneda,M.V., Lee,M.H., Latres,E., Polyak,K., Lacombe,L., Montgomery,K., Mathew,S., Krauter,K., Sheinfeld,J., Massague,J. et al.
Journal Cancer Res. 55 (6), 1211-1214 (1995)
Title Assignment of the human p27Kip1 gene to 12p13 and its analysis in leukemias .
Author Pietenpol,J.A., Bohlander,S.K., Sato,Y., Papadopoulos,N., Liu,B., Friedman,C., Trask,B.J., Roberts,J.M., Kinzler,K.W., Rowley,J.D. et al.
Journal Cancer Res. 55 (6), 1206-1210 (1995)
Title Chromosomal mapping of members of the cdc2 family of protein kinases, cdk3, cdk6, PISSLRE, and PITALRE, and a cdk inhibitor, p27Kip1, to regions involved in human cancer .
Author Bullrich,F., MacLachlan,T.K., Sang,N., Druck,T., Veronese,M.L., Allen,S.L., Chiorazzi,N., Koff,A., Heubner,K., Croce,C.M. et al.
Journal Cancer Res. 55 (6), 1199-1205 (1995)
Title Purification of CpG islands using a methylated DNA binding column .
Author Cross,S.H., Charlton,J.A., Nan,X. and Bird,A.P.
Journal Nat. Genet. 6 (3), 236-244 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878