• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cyclin-dependent kinase inhibitor 1B (p27, Kip1) (CDKN1B), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27895 Homo sapiens cyclin-dependent kinase inhibitor 1B (p27, Kip1) (CDKN1B), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu27895C Homo sapiens cyclin-dependent kinase inhibitor 1B (p27, Kip1) (CDKN1B), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_004064.4, 584458479
Length 597 bp
Structure linear
Update Date 07-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens cyclin-dependent kinase inhibitor 1B (p27, Kip1) (CDKN1B), mRNA.
Product cyclin-dependent kinase inhibitor 1B
Comment

Summary: This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4). [provided by RefSeq, Apr 2014].

RefSeq NP_004055.1
CDS 571..1167
Misc Feature(1)52..141
Misc Feature(2)496..498
Misc Feature(3)598..600
Misc Feature(4)598..600
Misc Feature(5)598..600
Misc Feature(6)658..810
Misc Feature(7)790..792
Misc Feature(8)790..792
Misc Feature(9)790..792
Misc Feature(10)832..834
Misc Feature(11)832..834
Misc Feature(12)832..834
Misc Feature(13)832..834
Misc Feature(14)832..834
Misc Feature(15)835..837
Misc Feature(16)988..990
Misc Feature(17)1027..1077
Misc Feature(18)1039..1041
Misc Feature(19)1039..1041
Misc Feature(20)1129..1131
Misc Feature(21)1129..1131
Misc Feature(22)1129..1131
Misc Feature(23)1162..1164
Misc Feature(24)1162..1164
Exon (1)1..1045
Gene:CDKN1B
Gene Synonym:CDKN4; KIP1; MEN1B; MEN4; P27KIP1
Exon (2)1046..1175
Gene:CDKN1B
Gene Synonym:CDKN4; KIP1; MEN1B; MEN4; P27KIP1
Exon (3)1176..2523
Gene:CDKN1B
Gene Synonym:CDKN4; KIP1; MEN1B; MEN4; P27KIP1
Translation MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN AGSVEQTPKKPGLRRRQT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
33..34+dbSNP:
33..34+, ggcdbSNP:377637464
134+a, gdbSNP:375987059
200+c, gdbSNP:11550615
305+c, gdbSNP:3093728
329+c, tdbSNP:191541352
369+c, tdbSNP:183710253
487+c, gdbSNP:115834392
492+c, tdbSNP:34330
547+c, tdbSNP:368268044
559+c, tdbSNP:372535829
561+c, tdbSNP:374913823
562+a, gdbSNP:202167434
590+c, gdbSNP:368157535
594+c, tdbSNP:371308246
613+c, tdbSNP:2066828
624+c, tdbSNP:151027466
645+a, gdbSNP:367611328
669+c, tdbSNP:201349921
674+c, tdbSNP:375297371
684+c, tdbSNP:141178987
695+c, tdbSNP:200422211
712+c, tdbSNP:375515128
721+g, tdbSNP:369554045
735+a, gdbSNP:16908375
738+c, tdbSNP:35456792
747+a, gdbSNP:140927518
795+c, gdbSNP:139727620
797+a, gdbSNP:121917832
816+c, tdbSNP:376624980
828+a, gdbSNP:142940486
831+c, tdbSNP:368696530
834+c, tdbSNP:374493057
846+g, tdbSNP:146161282
847+c, tdbSNP:140167393
850+c, tdbSNP:146217922
853+c, tdbSNP:188579132
854+c, gdbSNP:200141048
891+g, tdbSNP:370811357
896+g, tdbSNP:2066827
915+a, gdbSNP:199570763
926+c, tdbSNP:142833529
932+c, tdbSNP:201685429
935+c, tdbSNP:146973564
957+c, tdbSNP:377573215
967+a, cdbSNP:137985549
980+c, tdbSNP:369871673
996+a, gdbSNP:149775942
1013+g, tdbSNP:200476090
1034+c, gdbSNP:143879243
1052+dbSNP:
1052+c, gdbSNP:373917399
1088+a, gdbSNP:141509450
1100+c, gdbSNP:146167605
1113+c, gdbSNP:140177202
1147+c, tdbSNP:73281150
1149+c, tdbSNP:201701670
1157+a, gdbSNP:112962540
1159+a, cdbSNP:375717769
1174+c, tdbSNP:200321335
1197..1198+dbSNP:
1197..1198+, tdbSNP:375203013
1264+g, tdbSNP:114975362
1311+a, cdbSNP:368340132
1348+c, tdbSNP:4251696
1382+a, gdbSNP:374976127
1426+c, tdbSNP:79141596
1483+c, tdbSNP:201691620
1502+a, gdbSNP:192945515
1534+a, gdbSNP:1042935
1599+g, tdbSNP:146111672
1620+a, gdbSNP:139019732
1661+c, gdbSNP:183142712
1668+a, gdbSNP:4251697
1777+a, tdbSNP:4251698
1972+c, tdbSNP:1042937
2000+a, tdbSNP:141549130
2123+a, cdbSNP:7330
2159+a, gdbSNP:187299006
complement(2211)-c, adbSNP:10237
2431+a, gdbSNP:192280810
2496+a, tdbSNP:184666485
2519+a, tdbSNP:189357520
Gene SymbolCDKN1B
Gene SynonymCDKN4; KIP1; MEN1B; MEN4; P27KIP1
Chromosome12
Locus Map12p13.1-p12
Title TGF-beta1 stimulates human Tenon's capsule fibroblast proliferation by miR-200b and its targeting of p27/kip1 and RND3 .
Author Tong J, Fu Y, Xu X, Fan S, Sun H, Liang Y, Xu K, Yuan Z and Ge Y.
Journal Invest. Ophthalmol. Vis. Sci. 55 (4), 2747-2756 (2014)
Title KLRG1 impairs CD4+ T cell responses via p16ink4a and p27kip1 pathways: role in hepatitis B vaccine failure in individuals with hepatitis C virus infection .
Author Shi L, Wang JM, Ren JP, Cheng YQ, Ying RS, Wu XY, Lin SM, Griffin JW, Li GY, Moorman JP and Yao ZQ.
Journal J. Immunol. 192 (2), 649-657 (2014)
Title Novel functions of core cell cycle regulators in neuronal migration .
Author Godin JD and Nguyen L.
Journal Adv. Exp. Med. Biol. 800, 59-74 (2014)
Title A novel mutation in the upstream open reading frame of the CDKN1B gene causes a MEN4 phenotype .
Author Occhi G, Regazzo D, Trivellin G, Boaretto F, Ciato D, Bobisse S, Ferasin S, Cetani F, Pardi E, Korbonits M, Pellegata NS, Sidarovich V, Quattrone A, Opocher G, Mantero F and Scaroni C.
Journal PLoS Genet. 9 (3), E1003350 (2013)
Title Germ-line mutations in p27Kip1 cause a multiple endocrine neoplasia syndrome in rats and humans .
Author Pellegata NS, Quintanilla-Martinez L, Siggelkow H, Samson E, Bink K, Hofler H, Fend F, Graw J and Atkinson MJ.
Journal Proc. Natl. Acad. Sci. U.S.A. 103 (42), 15558-15563 (2006)
Title Cell cycle-dependent translation of p27 involves a responsive element in its 5'-UTR that overlaps with a uORF .
Author Gopfert U, Kullmann M and Hengst L.
Journal Hum. Mol. Genet. 12 (14), 1767-1779 (2003)
Title ELAV/Hu proteins inhibit p27 translation via an IRES element in the p27 5'UTR .
Author Kullmann M, Gopfert U, Siewe B and Hengst L.
Journal Genes Dev. 16 (23), 3087-3099 (2002)
Title Evidence for different modes of action of cyclin-dependent kinase inhibitors: p15 and p16 bind to kinases, p21 and p27 bind to cyclins .
Author Hall M, Bates S and Peters G.
Journal Oncogene 11 (8), 1581-1588 (1995)
Title Assignment of the human p27Kip1 gene to 12p13 and its analysis in leukemias .
Author Pietenpol JA, Bohlander SK, Sato Y, Papadopoulos N, Liu B, Friedman C, Trask BJ, Roberts JM, Kinzler KW and Rowley JD.
Journal Cancer Res. 55 (6), 1206-1210 (1995)
Title Chromosomal mapping of members of the cdc2 family of protein kinases, cdk3, cdk6, PISSLRE, and PITALRE, and a cdk inhibitor, p27Kip1, to regions involved in human cancer .
Author Bullrich F, MacLachlan TK, Sang N, Druck T, Veronese ML, Allen SL, Chiorazzi N, Koff A, Heubner K and Croce CM.
Journal Cancer Res. 55 (6), 1199-1205 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.