• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fms-related tyrosine kinase 3 (FLT3), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_004119 Homo sapiens fms-related tyrosine kinase 3 (FLT3), mRNA. GenEZ ORF Cloning In-stock $809.00 $760.00 15

*Business Day

Related Services

RefSeq Version NM_004119.2, 121114303
Length 3848 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens fms-related tyrosine kinase 3 (FLT3), mRNA.
Product receptor-type tyrosine-protein kinase FLT3
Comment

Summary: This gene encodes a class III receptor tyrosine kinase that regulates hematopoiesis. The receptor consists of an extracellular domain composed of five immunoglobulin-like domains, one transmembrane region, and a cytoplasmic kinase domain split into two parts by a kinase-insert domain. The receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia. [provided by RefSeq, Jul 2008].

RefSeq NP_004110.2
CDS 83..3064
Misc Feature(1)875..1075
Misc Feature(2)875..1075
Misc Feature(3)1712..1771
Misc Feature(4)1793..2923
Misc Feature(5)1796..1798
Misc Feature(6)1802..1804
Misc Feature(7)1847..1849
Misc Feature(8)1847..1849
Misc Feature(9)1853..1873
Misc Feature(10)1853..1855
Misc Feature(11)1853..1855
Misc Feature(12)1871..1873
Misc Feature(13)1877..1879
Misc Feature(14)1877..1879
Misc Feature(15)order(1928..1942,1952..1954,2006..2008,2012..2014,
Misc Feature(16)order(1928..1942,1952..1954,2006..2008,2012..2014,
Misc Feature(17)order(1940..1942,2174..2176,2180..2182,2513..2515,
Misc Feature(18)2258..2260
Misc Feature(19)2357..2359
Misc Feature(20)2384..2386
Misc Feature(21)<2429..2911
Misc Feature(22)2459..2461
Misc Feature(23)order(2564..2584,2630..2641)
Misc Feature(24)2606..2608
Misc Feature(25)2945..2947
Misc Feature(26)2987..2989
Misc Feature(27)3059..3061
Exon (1)1..125
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (2)126..247
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (3)248..450
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (4)451..566
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (5)567..696
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (6)697..824
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (7)825..964
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (8)965..1118
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (9)1119..1287
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (10)1288..1391
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (11)1392..1500
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (12)1501..1679
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (13)1680..1786
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (14)1787..1919
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (15)1920..2024
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (16)2025..2135
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (17)2136..2289
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (18)2290..2372
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (19)2373..2500
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (20)2501..2623
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (21)2624..2735
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (22)2736..2835
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (23)2836..2941
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Exon (24)2942..3842
Gene:FLT3
Gene Synonym:CD135; FLK-2; FLK2; STK1
Translation MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP EDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL QNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITE GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG RVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(102)-t, cdbSNP:12872889
complement(128)-dbSNP:
complement(128)-g, cdbSNP:62636526
complement(163)-g, adbSNP:188418054
complement(178)-g, cdbSNP:149370695
complement(203)-t, cdbSNP:139579569
complement(268)-dbSNP:
complement(268)-g, adbSNP:147453280
complement(284)-t, cdbSNP:201649330
complement(320)-c, adbSNP:200841206
complement(370)-g, adbSNP:7338903
complement(371)-t, cdbSNP:55975001
complement(372)-g, adbSNP:55784328
complement(414)-g, adbSNP:144209806
complement(508)-dbSNP:
complement(508)-t, cdbSNP:140179702
complement(531)-g, adbSNP:150917050
complement(555)-g, adbSNP:56321896
complement(581)-dbSNP:
complement(581)-t, cdbSNP:201266613
complement(606)-t, cdbSNP:201651411
complement(622)-g, adbSNP:56033040
complement(647)-t, cdbSNP:142392340
complement(662)-t, cdbSNP:146030737
complement(674)-g, adbSNP:144349858
complement(679)-g, adbSNP:142820970
complement(697)-dbSNP:
complement(697)-t, gdbSNP:77496417
complement(737)-t, cdbSNP:138331200
complement(762)-t, cdbSNP:1933437
complement(795)-c, adbSNP:141994172
complement(810)-t, cdbSNP:61729144
complement(811)-g, cdbSNP:200522693
complement(882)-dbSNP:
complement(882)-g, c, adbSNP:117240821
complement(905)-t, cdbSNP:199643702
complement(919)-g, adbSNP:140893123
complement(946)-t, gdbSNP:200102131
complement(958)-g, adbSNP:201609515
complement(1010)-dbSNP:
complement(1010)-t, adbSNP:201692456
complement(1052)-t, cdbSNP:35602083
complement(1060)-t, cdbSNP:200546928
complement(1096)-t, cdbSNP:199500977
complement(1114)-g, adbSNP:146983744
complement(1127)-dbSNP:
complement(1127)-g, adbSNP:141185874
complement(1155)-t, adbSNP:34172843
complement(1331)-dbSNP:
complement(1331)-t, gdbSNP:56090538
complement(1355)-t, cdbSNP:200949858
complement(1360)-t, cdbSNP:56152292
complement(1377)-g, adbSNP:201905189
complement(1383)-t, cdbSNP:145857550
complement(1384)-g, adbSNP:149842351
complement(1403)-dbSNP:
complement(1403)-t, cdbSNP:139990734
complement(1417)-t, cdbSNP:141302013
complement(1419)-g, adbSNP:201256911
complement(1420)-t, cdbSNP:146109614
complement(1431)-g, adbSNP:144444671
complement(1432)-c, adbSNP:139619024
complement(1466)-t, adbSNP:147819024
complement(1505)-dbSNP:
complement(1505)-t, gdbSNP:149057582
complement(1510)-t, cdbSNP:201305527
complement(1520)-t, cdbSNP:146341559
complement(1560)-t, c, adbSNP:141942072
complement(1588)-g, adbSNP:144974073
complement(1601)-t, cdbSNP:202109868
complement(1660)-g, cdbSNP:58490213
complement(1708)-dbSNP:
complement(1708)-g, cdbSNP:144247060
complement(1751)-t, cdbSNP:35958982
complement(1765)-t, cdbSNP:34374211
complement(1797)-dbSNP:
complement(1797)-g, adbSNP:121913491
complement(1807)-c, adbSNP:189166547
complement(1828)-g, adbSNP:146980710
complement(1852)-t, g, adbSNP:141380985
complement(1855)-g, adbSNP:115466624
complement(1897)-g, adbSNP:61729139
complement(1936)-dbSNP:
complement(1936)-t, cdbSNP:140784892
complement(1975)-t, cdbSNP:150919208
complement(2005)-, adbSNP:67319162
complement(2041)-dbSNP:
complement(2041)-t, adbSNP:142515613
complement(2095)-g, adbSNP:149216274
complement(2132)-g, adbSNP:199906407
complement(2293)-dbSNP:
complement(2293)-g, cdbSNP:148592477
complement(2294)-g, adbSNP:146649334
complement(2295)-g, cdbSNP:144381194
complement(2296)-t, adbSNP:139724603
complement(2372)-c, adbSNP:146853291
complement(2394)-dbSNP:
complement(2394)-t, gdbSNP:149791635
complement(2418)-t, adbSNP:201232010
complement(2425)-g, adbSNP:150581819
complement(2465)-t, cdbSNP:139776505
complement(2497)-t, cdbSNP:150603645
complement(2521)-dbSNP:
complement(2521)-g, adbSNP:141860068
complement(2522)-c, adbSNP:201208287
complement(2545)-g, adbSNP:200403408
complement(2546)-t, cdbSNP:148480385
complement(2585..2587)-, gatdbSNP:121913486
complement(2585)-t, g, c, adbSNP:121913488
complement(2586)-t, adbSNP:121909646
complement(2587)-t, adbSNP:121913487
complement(2588..2590)-, atcdbSNP:121913490
complement(2590)-g, cdbSNP:121913232
complement(2628)-dbSNP:
complement(2628)-t, cdbSNP:201923726
complement(2638)-t, gdbSNP:147075807
complement(2678)-t, cdbSNP:201398123
complement(2740)-dbSNP:
complement(2740)-g, cdbSNP:147438268
complement(2751)-g, cdbSNP:142796469
complement(2761)-t, cdbSNP:56300022
complement(2763)-g, adbSNP:75849452
complement(2804)-t, cdbSNP:200909894
complement(2807)-g, cdbSNP:201504848
complement(2905)-t, cdbSNP:201025099
complement(2938)-t, cdbSNP:111892726
complement(2940)-g, adbSNP:145998293
complement(2963)-dbSNP:
complement(2963)-g, cdbSNP:149473536
complement(2970)-g, adbSNP:138003347
complement(2971)-t, cdbSNP:183293726
complement(2972)-t, cdbSNP:147467327
complement(2999)-g, adbSNP:191501493
complement(3000)-t, cdbSNP:144397269
complement(3032)-g, adbSNP:140123333
complement(3040)-t, cdbSNP:56027115
complement(3044)-g, cdbSNP:74041526
complement(3061)-t, cdbSNP:142922228
complement(3062)-g, adbSNP:187882824
complement(3074)-c, adbSNP:200471125
complement(3288)-g, adbSNP:182411742
complement(3296)-g, adbSNP:79240208
complement(3324)-t, cdbSNP:1042106
complement(3414)-g, adbSNP:189844359
complement(3439)-t, cdbSNP:111552438
complement(3565)-t, gdbSNP:3829382
complement(3580)-t, gdbSNP:59251752
complement(3609)-t, cdbSNP:185137504
complement(3614)-g, adbSNP:138434705
complement(3632)-t, cdbSNP:181954154
complement(3640..3641)-, cdbSNP:34517967
complement(3671)-g, adbSNP:73436930
complement(3699)-g, adbSNP:35613052
complement(3704..3705)-, cdbSNP:144851128
complement(3728)-t, gdbSNP:190904178
complement(3802)-c, adbSNP:146373179
complement(3811..3818)-, gaaaatacdbSNP:201755749
complement(3820)-t, cdbSNP:142027185
Gene SymbolFLT3
Gene SynonymCD135; FLK-2; FLK2; STK1
Chromosome13
Locus Map13q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004119 Homo sapiens fms-related tyrosine kinase 3 (FLT3), mRNA. In-stock $809.00 $760.00 15
Title Prognostic impact of allogeneic hematopoietic stem cell transplantation for acute myeloid leukemia patients with internal tandem duplication of FLT3 .
Author Lin,P.H., Lin,C.C., Yang,H.I., Li,L.Y., Bai,L.Y., Chiu,C.F., Liao,Y.M., Lin,C.Y., Hsieh,C.Y., Lin,C.Y., Ho,C.M., Yang,S.F., Peng,C.T., Tsai,F.J. and Yeh,S.P.
Journal Leuk. Res. 37 (3), 287-292 (2013)
Title Whole-genome-amplified DNA as a source for mutational analysis underestimates the frequency of mutations in pediatric acute myeloid leukemia .
Author Rosenquist,R., Ehrencrona,H., Hasle,H., Palle,J. and Kanduri,M.
Journal Leukemia 27 (2), 510-512 (2013)
Title FLT3 mutations in myelodysplastic syndrome and chronic myelomonocytic leukemia .
Author Daver,N., Strati,P., Jabbour,E., Kadia,T., Luthra,R., Wang,S., Patel,K., Ravandi,F., Cortes,J., Qin Dong,X., Kantarjian,H. and Garcia-Manero,G.
Journal Am. J. Hematol. 88 (1), 56-59 (2013)
Title Refining the diagnosis and prognostic categorization of acute myeloid leukemia patients with an integrated use of cytogenetic and molecular studies .
Author Costa,D., Vidal,A., Carrio,A., Munoz,C., Arias,A., Gomez,C., Berneaga,D., Colomer,D., Rozman,M., Pratcorona,M., Torrebadell,M., Diaz-Beya,M., Esteve,J. and Campo,E.
Journal Acta Haematol. 129 (2), 65-71 (2013)
Title Prognostic significance of FLT3 internal tandem duplication in egyptian patients with acute myeloid leukemia with normal or favorable risk cytogenetics .
Author Shahin,D., Aly,R. and Ebrahim,M.A.
Journal Egypt J Immunol 17 (2), 23-32 (2010)
Title FMS-like tyrosine kinase 3 in normal hematopoiesis and acute myeloid leukemia .
Author Parcells,B.W., Ikeda,A.K., Simms-Waldrip,T., Moore,T.B. and Sakamoto,K.M.
Journal Stem Cells 24 (5), 1174-1184 (2006)
Title Localization of the human stem cell tyrosine kinase-1 gene (FLT3) to 13q12-->q13 .
Author Carow,C.E., Kim,E., Hawkins,A.L., Webb,H.D., Griffin,C.A., Jabs,E.W., Civin,C.I. and Small,D.
Journal Cytogenet. Cell Genet. 70 (3-4), 255-257 (1995)
Title STK-1, the human homolog of Flk-2/Flt-3, is selectively expressed in CD34+ human bone marrow cells and is involved in the proliferation of early progenitor/stem cells .
Author Small,D., Levenstein,M., Kim,E., Carow,C., Amin,S., Rockwell,P., Witte,L., Burrow,C., Ratajczak,M.Z., Gewirtz,A.M. et al.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (2), 459-463 (1994)
Title Mitogenic signalling and substrate specificity of the Flk2/Flt3 receptor tyrosine kinase in fibroblasts and interleukin 3-dependent hematopoietic cells .
Author Dosil,M., Wang,S. and Lemischka,I.R.
Journal Mol. Cell. Biol. 13 (10), 6572-6585 (1993)
Title Isolation and chromosomal localization of a novel FMS-like tyrosine kinase gene .
Author Rosnet,O., Mattei,M.G., Marchetto,S. and Birnbaum,D.
Journal Genomics 9 (2), 380-385 (1991)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.