Sequence in raw or FASTA format:
Homo sapiens fms-related tyrosine kinase 3 (FLT3), mRNA.
| RefSeq Version | NM_004119.2, 121114303 |
| Length | 3848 bp |
| Structure | linear |
| Update Date | 03-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens fms-related tyrosine kinase 3 (FLT3), mRNA. |
| Product | FL cytokine receptor precursor |
| Comment | Summary: This gene encodes a class III receptor tyrosine kinase that regulates hematopoiesis. The receptor consists of an extracellular domain composed of five immunoglobulin-like domains, one transmembrane region, and a cytoplasmic kinase domain split into two parts by a kinase-insert domain. The receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia. [provided by RefSeq]. |
| RefSeq | NP_004110.2 |
| CDS | 83..3064 | Exon (1) | 1..125 | Exon (2) | 1..125 | Exon (3) | 126..247 | Exon (4) | 248..450 | Exon (5) | 451..566 | Exon (6) | 567..696 | Exon (7) | 697..824 | Exon (8) | 825..964 | Exon (9) | 965..1118 | Exon (10) | 1119..1287 | Exon (11) | 1288..1391 | Exon (12) | 1392..1500 | Exon (13) | 1501..1679 | Exon (14) | 1680..1786 | Exon (15) | 1787..1919 | Exon (16) | 1920..2024 | Exon (17) | 2025..2135 | Exon (18) | 2136..2289 | Exon (19) | 2290..2372 | Exon (20) | 2373..2500 | Exon (21) | 2501..2623 | Exon (22) | 2624..2735 | Exon (23) | 2736..2835 | Exon (24) | 2836..2941 | Exon (25) | 2942..3842 |
| Translation | MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
QNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE
CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA
ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITE
GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD
NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG
RVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(102) | - | t, c | dbSNP:12872889 |
| complement(128) | - | g, c | dbSNP:62636526 |
| complement(370) | - | g, a | dbSNP:7338903 |
| complement(371) | - | t, c | dbSNP:55975001 |
| complement(372) | - | g, a | dbSNP:55784328 |
| complement(555) | - | g, a | dbSNP:56321896 |
| complement(622) | - | g, a | dbSNP:56033040 |
| complement(697) | - | t, g | dbSNP:77496417 |
| 762 | + | c, t | dbSNP:1933437 |
| complement(810) | - | t, c | dbSNP:61729144 |
| complement(882) | - | g, c | dbSNP:117240821 |
| complement(1052) | - | t, c | dbSNP:35602083 |
| complement(1155) | - | t, a | dbSNP:34172843 |
| complement(1331) | - | t, g | dbSNP:56090538 |
| complement(1360) | - | t, c | dbSNP:56152292 |
| complement(1660) | - | g, c | dbSNP:58490213 |
| complement(1751) | - | t, c | dbSNP:35958982 |
| complement(1765) | - | t, c | dbSNP:34374211 |
| 1797 | + | a, g | dbSNP:121913491 |
| complement(1855) | - | g, a | dbSNP:115466624 |
| complement(1897) | - | g, a | dbSNP:61729139 |
| complement(2004) | - | , a | dbSNP:67319162 |
| 2585..2587 | + | , gat | dbSNP:121913486 |
| 2585 | + | a, g | dbSNP:121909648 |
| 2585 | + | c, g | dbSNP:121913488 |
| 2585 | + | c, g | dbSNP:121909647 |
| 2585 | + | g, t | dbSNP:121913489 |
| 2585 | + | g, t | dbSNP:121909649 |
| 2586 | + | a, t | dbSNP:121909646 |
| 2587 | + | a, t | dbSNP:121913487 |
| 2588..2590 | + | , atc | dbSNP:121913490 |
| 2590 | + | c, g | dbSNP:121913232 |
| complement(2701) | - | t, c | dbSNP:74706772 |
| complement(2761) | - | t, c | dbSNP:56300022 |
| complement(2763) | - | g, a | dbSNP:75849452 |
| complement(2938) | - | t, c | dbSNP:111892726 |
| complement(3040) | - | t, c | dbSNP:56027115 |
| complement(3044) | - | g, c | dbSNP:74041526 |
| complement(3296) | - | g, a | dbSNP:79240208 |
| 3324 | + | c, t | dbSNP:1042106 |
| complement(3439) | - | t, c | dbSNP:111552438 |
| complement(3565) | - | t, g | dbSNP:3829382 |
| complement(3580) | - | t, g | dbSNP:59251752 |
| complement(3640..3641) | - | , c | dbSNP:34517967 |
| complement(3671) | - | g, a | dbSNP:73436930 |
| complement(3699) | - | g, a | dbSNP:35613052 |
| Title | FLT3 internal tandem duplication is associated with a high relapse rate and central nervous system involvement in acute promyelocytic leukemia cases: single institutional analysis . |
| Author | Tashiro,H., Shirasaki,R., Oka,Y., Sugao,T., Mizutani-Noguchi,M., Yamamoto,T., Akiyama,N., Kawasugi,K. and Shirafuji,N. |
| Journal | Eur. J. Haematol. 86 (3), 272-273 (2011) |
| Title | FLT3/ ITD regulates leukaemia cell adhesion through alpha4beta1 integrin and Pyk2 signalling . |
| Author | Katsumi,A., Kiyoi,H., Abe,A., Tanizaki,R., Iwasaki,T., Kobayashi,M., Matsushita,T., Kaibuchi,K., Senga,T., Kojima,T., Kohno,T., Hamaguchi,M. and Naoe,T. |
| Journal | Eur. J. Haematol. 86 (3), 191-198 (2011) |
| Title | FLT3 and NPM1 mutations in myelodysplastic syndromes: Frequency and potential value for predicting progression to acute myeloid leukemia . |
| Author | Bains,A., Luthra,R., Medeiros,L.J. and Zuo,Z. |
| Journal | Am. J. Clin. Pathol. 135 (1), 62-69 (2011) |
| Title | Clinical relevance of FLT3 receptor protein expression in Indian patients with acute leukemia . |
| Author | Vora,H.H., Shukla,S.N., Brahambhatt,B.V., Mehta,S.H., Patel,N.A., Parikh,S.K., Shah,K.N. and Shah,P.M. |
| Journal | Asia Pac J Clin Oncol 6 (4), 306-319 (2010) |
| Title | [JAK2-V617F mutation in patients with myeloproliferative neoplasms: association with FLT3-ITD mutation] . |
| Author | Spasovski,V., Tosic,N., Kostic,T., Pavlovic,S. and Colovic,M. |
| Journal | Srp Arh Celok Lek 138 (9-10), 614-618 (2010) |
| Title | FMS-like tyrosine kinase 3 in normal hematopoiesis and acute myeloid leukemia . |
| Author | Parcells,B.W., Ikeda,A.K., Simms-Waldrip,T., Moore,T.B. and Sakamoto,K.M. |
| Journal | Stem Cells 24 (5), 1174-1184 (2006) |
| Title | Localization of the human stem cell tyrosine kinase-1 gene (FLT3) to 13q12-->q13 . |
| Author | Carow,C.E., Kim,E., Hawkins,A.L., Webb,H.D., Griffin,C.A., Jabs,E.W., Civin,C.I. and Small,D. |
| Journal | Cytogenet. Cell Genet. 70 (3-4), 255-257 (1995) |
| Title | STK-1, the human homolog of Flk-2/Flt-3, is selectively expressed in CD34+ human bone marrow cells and is involved in the proliferation of early progenitor/stem cells . |
| Author | Small,D., Levenstein,M., Kim,E., Carow,C., Amin,S., Rockwell,P., Witte,L., Burrow,C., Ratajczak,M.Z., Gewirtz,A.M. et al. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 91 (2), 459-463 (1994) |
| Title | Mitogenic signalling and substrate specificity of the Flk2/Flt3 receptor tyrosine kinase in fibroblasts and interleukin 3-dependent hematopoietic cells . |
| Author | Dosil,M., Wang,S. and Lemischka,I.R. |
| Journal | Mol. Cell. Biol. 13 (10), 6572-6585 (1993) |
| Title | Isolation and chromosomal localization of a novel FMS-like tyrosine kinase gene . |
| Author | Rosnet,O., Mattei,M.G., Marchetto,S. and Birnbaum,D. |
| Journal | Genomics 9 (2), 380-385 (1991) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |