Homo sapiens gastric inhibitory polypeptide (GIP), mRNA.
| RefSeq Version | NM_004123.2, 62243447 |
| Length | 711 bp |
| Structure | linear |
| Update Date | 24-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens gastric inhibitory polypeptide (GIP), mRNA. |
| Product | gastric inhibitory polypeptide preproprotein |
| Comment | Summary: This gene encodes an incretin hormone and belongs to the glucagon superfamily. The encoded protein is important in maintaining glucose homeostasis as it is a potent stimulator of insulin secretion from pancreatic beta-cells following food ingestion and nutrient absorption. This gene stimulates insulin secretion via its G protein-coupled receptor activation of adenylyl cyclase and other signal transduction pathways. It is a relatively poor inhibitor of gastric acid secretion. [provided by RefSeq]. |
| RefSeq | NP_004114.1 |
| CDS | 99..560 | Exon (1) | 1..77 | Exon (2) | 1..77 | Exon (3) | 78..184 | Exon (4) | 185..355 | Exon (5) | 356..448 | Exon (6) | 449..550 | Exon (7) | 551..711 |
| Translation | MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISD
YSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPA
KNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(201) | - | t, g | dbSNP:61733693 |
| complement(405) | - | t, c | dbSNP:2291725 |
| 535 | + | a, g | dbSNP:35703924 |
| complement(586) | - | g, c | dbSNP:72833611 |
| complement(587) | - | c, a | dbSNP:55936433 |
| Title | Adaptive selection of an incretin gene in Eurasian populations . |
| Author | Chang,C.L., Cai,J.J., Lo,C., Amigo,J., Park,J.I. and Hsu,S.Y. |
| Journal | Genome Res. 21 (1), 21-32 (2011) |
| Title | Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease . |
| Author | Schunkert,H., Konig,I.R., Kathiresan,S., Reilly,M.P., Assimes,T.L., Holm,H., Preuss,M., Stewart,A.F., Barbalic,M., Gieger,C., Absher,D., Aherrahrou,Z., Allayee,H., Altshuler,D., Anand,S.S., Andersen,K., Anderson,J.L., Ardissino,D., Ball,S.G., Balmforth,A.J., Barnes,T.A., Becker,D.M., Becker,L.C., Berger,K., Bis,J.C., Boekholdt,S.M., Boerwinkle,E., Braund,P.S., Brown,M.J., Burnett,M.S., Buysschaert,I., Carlquist,J.F., Chen,L., Cichon,S., Codd,V., Davies,R.W., Dedoussis,G., Dehghan,A., Demissie,S., Devaney,J.M., Diemert,P., Do,R., Doering,A., Eifert,S., Mokhtari,N.E., Ellis,S.G., Elosua,R., Engert,J.C., Epstein,S.E., de Faire,U., Fischer,M., Folsom,A.R., Freyer,J., Gigante,B., Girelli,D., Gretarsdottir,S., Gudnason,V., Gulcher,J.R., Halperin,E., Hammond,N., Hazen,S.L., Hofman,A., Horne,B.D., Illig,T., Iribarren,C., Jones,G.T., Jukema,J.W., Kaiser,M.A., Kaplan,L.M., Kastelein,J.J., Khaw,K.T., Knowles,J.W., Kolovou,G., Kong,A., Laaksonen,R., Lambrechts,D., Leander,K., Lettre,G., Li,M., Lieb,W., Loley,C., Lotery,A.J., Mannucci,P.M., Maouche,S., Martinelli,N., McKeown,P.P., Meisinger,C., Meitinger,T., Melander,O., Merlini,P.A., Mooser,V., Morgan,T., Muhleisen,T.W., Muhlestein,J.B., Munzel,T., Musunuru,K., Nahrstaedt,J., Nelson,C.P., Nothen,M.M., Olivieri,O., Patel,R.S., Patterson,C.C., Peters,A., Peyvandi,F., Qu,L., Quyyumi,A.A., Rader,D.J., Rallidis,L.S., Rice,C., Rosendaal,F.R., Rubin,D., Salomaa,V., Sampietro,M.L., Sandhu,M.S., Schadt,E., Schafer,A., Schillert,A., Schreiber,S., Schrezenmeir,J., Schwartz,S.M., Siscovick,D.S., Sivananthan,M., Sivapalaratnam,S., Smith,A., Smith,T.B., Snoep,J.D., Soranzo,N., Spertus,J.A., Stark,K., Stirrups,K., Stoll,M., Tang,W.H., Tennstedt,S., Thorgeirsson,G., Thorleifsson,G., Tomaszewski,M., Uitterlinden,A.G., van Rij,A.M., Voight,B.F., Wareham,N.J., Wells,G.A., Wichmann,H.E., Wild,P.S., Willenborg,C., Witteman,J.C., Wright,B.J., Ye,S., Zeller,T., Ziegler,A., Cambien,F., Goodall,A.H., Cupples,L.A., Quertermous,T., Marz,W., Hengstenberg,C., Blankenberg,S., Ouwehand,W.H., Hall,A.S., Deloukas,P., Thompson,J.R., Stefansson,K., Roberts,R., Thorsteinsdottir,U., O'Donnell,C.J., McPherson,R., Erdmann,J. and Samani,N.J. |
| Journal | Nat. Genet. 43 (4), 333-338 (2011) |
| Title | Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study . |
| Author | Flachsbart,F., Franke,A., Kleindorp,R., Caliebe,A., Blanche,H., Schreiber,S. and Nebel,A. |
| Journal | Mutat. Res. 694 (1-2), 13-19 (2010) |
| Title | Tyr1 and Ile7 of glucose-dependent insulinotropic polypeptide (GIP) confer differential ligand selectivity toward GIP and glucagon-like peptide-1 receptors . |
| Author | Moon,M.J., Kim,H.Y., Kim,S.G., Park,J., Choi,D.S., Hwang,J.I. and Seong,J.Y. |
| Journal | Mol. Cells 30 (2), 149-154 (2010) |
| Title | A case-control analysis of common variants in GIP with type 2 diabetes and related biochemical parameters in a South Indian population . |
| Author | Sugunan,D., Nair,A.K., Kumar,H. and Gopalakrishnapillai,A. |
| Journal | BMC Med. Genet. 11, 118 (2010) |
| Title | GLP-1/GIP chimeric peptides define the structural requirements for specific ligand-receptor interaction of GLP-1 . |
| Author | Gallwitz,B., Witt,M., Morys-Wortmann,C., Folsch,U.R. and Schmidt,W.E. |
| Journal | Regul. Pept. 63 (1), 17-22 (1996) |
| Title | Molecular cloning, functional expression, and signal transduction of the GIP-receptor cloned from a human insulinoma . |
| Author | Volz,A., Goke,R., Lankat-Buttgereit,B., Fehmann,H.C., Bode,H.P. and Goke,B. |
| Journal | FEBS Lett. 373 (1), 23-29 (1995) |
| Title | Gastric inhibitory polypeptide: structure and chromosomal localization of the human gene . |
| Author | Inagaki,N., Seino,Y., Takeda,J., Yano,H., Yamada,Y., Bell,G.I., Eddy,R.L., Fukushima,Y., Byers,M.G., Shows,T.B. et al. |
| Journal | Mol. Endocrinol. 3 (6), 1014-1021 (1989) |
| Title | Sequence of an intestinal cDNA encoding human gastric inhibitory polypeptide precursor . |
| Author | Takeda,J., Seino,Y., Tanaka,K., Fukumoto,H., Kayano,T., Takahashi,H., Mitani,T., Kurono,M., Suzuki,T., Tobe,T. et al. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 84 (20), 7005-7008 (1987) |
| Title | The isolation and sequencing of human gastric inhibitory peptide (GIP) . |
| Author | Moody,A.J., Thim,L. and Valverde,I. |
| Journal | FEBS Lett. 172 (2), 142-148 (1984) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |