• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens prolactin releasing hormone receptor (PRLHR), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu30036 Homo sapiens prolactin releasing hormone receptor (PRLHR), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu30036C Homo sapiens prolactin releasing hormone receptor (PRLHR), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_004248.2, 103485497
Length 1113 bp
Structure linear
Update Date 26-JAN-2014
Organism Homo sapiens (human)
Definition Homo sapiens prolactin releasing hormone receptor (PRLHR), mRNA.
Product prolactin-releasing peptide receptor
Comment

Summary: PRLHR is a 7-transmembrane domain receptor for prolactin-releasing hormone (PRLH; MIM 602663) that is highly expressed in anterior pituitary (Ozawa et al., 2002 [PubMed 11923475]).[supplied by OMIM, Mar 2008].

RefSeq NP_004239.1
CDS 140..1252
Misc Feature(1)326..388
Misc Feature(2)326..388
Misc Feature(3)386..1144
Misc Feature(4)443..505
Misc Feature(5)518..580
Misc Feature(6)665..727
Misc Feature(7)815..877
Misc Feature(8)968..1030
Misc Feature(9)1091..1153
Misc Feature(10)1232..1249
Exon (1)1..133
Gene:PRLHR
Gene Synonym:GPR10; GR3; PrRPR
Exon (2)134..1980
Gene:PRLHR
Gene Synonym:GPR10; GR3; PrRPR
Translation MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK GLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAY AFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAV LAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLV ILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVVVVVFAVCWLPLHVFNLL RDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPH GQNMTVSVVI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(90)-dbSNP:
complement(90)-g, adbSNP:193214353
complement(179)-t, adbSNP:372035378
complement(194)-g, adbSNP:200043799
complement(195)-g, adbSNP:139960558
complement(269)-t, cdbSNP:139320666
complement(289)-g, adbSNP:12779703
complement(299)-g, cdbSNP:12779697
complement(305)-c, adbSNP:146905653
complement(337)-t, gdbSNP:12779509
complement(377)-g, adbSNP:142320607
complement(398)-g, adbSNP:201597278
complement(400)-t, cdbSNP:151033790
complement(423)-g, adbSNP:200412639
complement(424)-t, cdbSNP:938700
complement(555)-g, adbSNP:77447351
complement(571)-g, adbSNP:374957703
complement(580)-t, cdbSNP:145778038
complement(623)-c, adbSNP:144077709
complement(645)-t, cdbSNP:373828308
complement(657)-t, adbSNP:139325809
complement(663)-c, adbSNP:372161481
complement(667)-g, adbSNP:368733849
complement(693)-t, gdbSNP:116836026
754+g, tdbSNP:34269354
complement(757)-g, adbSNP:143477537
complement(767)-g, adbSNP:369106208
complement(787)-c, adbSNP:8192521
798+a, gdbSNP:8192522
complement(830)-g, adbSNP:375054225
complement(886)-t, gdbSNP:41300243
complement(902)-t, gdbSNP:370835454
complement(922)-t, cdbSNP:141649660
complement(936)-t, gdbSNP:148420320
complement(971)-g, adbSNP:377102767
complement(982)-t, cdbSNP:147384472
complement(986)-t, cdbSNP:1613448
complement(997)-c, adbSNP:116062593
complement(1018)-c, adbSNP:146851098
complement(1033)-g, adbSNP:76726569
1044+a, gdbSNP:8192523
complement(1053)-t, cdbSNP:8192524
complement(1120)-g, cdbSNP:150398561
complement(1122)-g, adbSNP:370359559
complement(1140)-t, adbSNP:187074990
complement(1175)-g, adbSNP:7068777
complement(1182)-t, cdbSNP:200210406
complement(1207)-t, cdbSNP:267602387
complement(1209)-c, adbSNP:377348944
complement(1217)-g, adbSNP:200268174
complement(1229)-t, cdbSNP:139127110
complement(1235)-t, cdbSNP:373039353
complement(1237)-g, adbSNP:182563197
complement(1250)-t, adbSNP:190691732
complement(1264)-g, adbSNP:150773080
complement(1272)-c, adbSNP:201179219
complement(1292)-t, cdbSNP:201607963
complement(1298)-t, gdbSNP:199675216
complement(1443)-c, adbSNP:41284406
complement(1474)-t, cdbSNP:1711869
complement(1553)-t, cdbSNP:36054377
complement(1630)-t, cdbSNP:148122135
complement(1670)-g, adbSNP:187377414
complement(1703)-g, cdbSNP:147450904
complement(1811)-g, adbSNP:374681116
complement(1828)-t, cdbSNP:200303015
complement(1860)-t, cdbSNP:142965424
Gene SymbolPRLHR
Gene SynonymGPR10; GR3; PrRPR
Chromosome10
Locus Map10q26.13
Title Loss of the repressor REST in uterine fibroids promotes aberrant G protein-coupled receptor 10 expression and activates mammalian target of rapamycin pathway .
Author Varghese BV, Koohestani F, McWilliams M, Colvin A, Gunewardena S, Kinsey WH, Nowak RA, Nothnick WB and Chennathukuzhi VM.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (6), 2187-2192 (2013)
Title Ligand-mimicking receptor variant discloses binding and activation mode of prolactin-releasing peptide .
Author Rathmann D, Lindner D, DeLuca SH, Kaufmann KW, Meiler J and Beck-Sickinger AG.
Journal J. Biol. Chem. 287 (38), 32181-32194 (2012)
Title Genome-wide association study identifies five loci associated with susceptibility to pancreatic cancer in Chinese populations .
Author Wu C, Miao X, Huang L, Che X, Jiang G, Yu D, Yang X, Cao G, Hu Z, Zhou Y, Zuo C, Wang C, Zhang X, Zhou Y, Yu X, Dai W, Li Z, Shen H, Liu L, Chen Y, Zhang S, Wang X, Zhai K, Chang J, Liu Y, Sun M, Cao W, Gao J, Ma Y, Zheng X, Cheung ST, Jia Y, Xu J, Tan W, Zhao P, Wu T, Wang C and Lin D.
Journal Nat. Genet. 44 (1), 62-66 (2012)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey SD, Xie C, Do R, Montpetit A, Diaz R, Mohan V, Keavney B, Yusuf S, Gerstein HC, Engert JC and Anand S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip .
Author Talmud PJ, Drenos F, Shah S, Shah T, Palmen J, Verzilli C, Gaunt TR, Pallas J, Lovering R, Li K, Casas JP, Sofat R, Kumari M, Rodriguez S, Johnson T, Newhouse SJ, Dominiczak A, Samani NJ, Caulfield M, Sever P, Stanton A, Shields DC, Padmanabhan S, Melander O, Hastie C, Delles C, Ebrahim S, Marmot MG, Smith GD, Lawlor DA, Munroe PB, Day IN, Kivimaki M, Whittaker J, Humphries SE and Hingorani AD.
Journal Am. J. Hum. Genet. 85 (5), 628-642 (2009)
Title Characterization of the binding of [(125)I]-human prolactin releasing peptide (PrRP) to GPR10, a novel G protein coupled receptor .
Author Langmead CJ, Szekeres PG, Chambers JK, Ratcliffe SJ, Jones DN, Hirst WD, Price GW and Herdon HJ.
Journal Br. J. Pharmacol. 131 (4), 683-688 (2000)
Title Tissue distribution of prolactin-releasing peptide (PrRP) and its receptor .
Author Fujii R, Fukusumi S, Hosoya M, Kawamata Y, Habata Y, Hinuma S, Sekiguchi M, Kitada C, Kurokawa T, Nishimura O, Onda H, Sumino Y and Fujino M.
Journal Regul. Pept. 83 (1), 1-10 (1999)
Title The quest for novel bioactive peptides utilizing orphan seven-transmembrane-domain receptors .
Author Hinuma S, Onda H and Fujino M.
Journal J. Mol. Med. 77 (6), 495-504 (1999)
Title A prolactin-releasing peptide in the brain .
Author Hinuma S, Habata Y, Fujii R, Kawamata Y, Hosoya M, Fukusumi S, Kitada C, Masuo Y, Asano T, Matsumoto H, Sekiguchi M, Kurokawa T, Nishimura O, Onda H and Fujino M.
Journal Nature 393 (6682), 272-276 (1998)
Title Cloning and chromosomal mapping of three novel genes, GPR9, GPR10, and GPR14, encoding receptors related to interleukin 8, neuropeptide Y, and somatostatin receptors .
Author Marchese A, Heiber M, Nguyen T, Heng HH, Saldivia VR, Cheng R, Murphy PM, Tsui LC, Shi X and Gregor P.
Journal Genomics 29 (2), 335-344 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.