• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens RecQ protein-like 4 (RECQL4), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_004260 Homo sapiens RecQ protein-like 4 (RECQL4), mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_004260.3, 284005308
Length 3840 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens RecQ protein-like 4 (RECQL4), mRNA.
Product ATP-dependent DNA helicase Q4
Comment

Summary: The protein encoded by this gene is a DNA helicase that belongs to the RecQ helicase family. DNA helicases unwind double-stranded DNA into single-stranded DNAs and may modulate chromosome segregation. This gene is predominantly expressed in thymus and testis. Mutations in this gene are associated with Rothmund-Thomson, RAPADILINO and Baller-Gerold syndromes. [provided by RefSeq, Jan 2010].

RefSeq NP_004251.3
CDS 43..3669
Misc Feature(1)58..>222
Misc Feature(2)58..>222
Misc Feature(3)1435..>2589
Misc Feature(4)1531..1920
Misc Feature(5)1555..1569
Misc Feature(6)1855..1866
Misc Feature(7)1855..1866
Misc Feature(8)2095..2493
Misc Feature(9)order(2164..2175,2275..2280,2353..2361)
Misc Feature(10)order(2377..2379,2440..2442,2452..2454,2461..2463)
Exon (1)1..126
Gene:RECQL4
Gene Synonym:RECQ4
Exon (2)127..160
Gene:RECQL4
Gene Synonym:RECQ4
Exon (3)161..255
Gene:RECQL4
Gene Synonym:RECQ4
Exon (4)256..396
Gene:RECQL4
Gene Synonym:RECQ4
Exon (5)397..1173
Gene:RECQL4
Gene Synonym:RECQ4
Exon (6)1174..1300
Gene:RECQL4
Gene Synonym:RECQ4
Exon (7)1301..1432
Gene:RECQL4
Gene Synonym:RECQ4
Exon (8)1433..1525
Gene:RECQL4
Gene Synonym:RECQ4
Exon (9)1526..1662
Gene:RECQL4
Gene Synonym:RECQ4
Exon (10)1663..1746
Gene:RECQL4
Gene Synonym:RECQ4
Exon (11)1747..1920
Gene:RECQL4
Gene Synonym:RECQ4
Exon (12)1921..2100
Gene:RECQL4
Gene Synonym:RECQ4
Exon (13)2101..2242
Gene:RECQL4
Gene Synonym:RECQ4
Exon (14)2243..2505
Gene:RECQL4
Gene Synonym:RECQ4
Exon (15)2506..2797
Gene:RECQL4
Gene Synonym:RECQ4
Exon (16)2798..2927
Gene:RECQL4
Gene Synonym:RECQ4
Exon (17)2928..3097
Gene:RECQL4
Gene Synonym:RECQ4
Exon (18)3098..3278
Gene:RECQL4
Gene Synonym:RECQ4
Exon (19)3279..3435
Gene:RECQL4
Gene Synonym:RECQ4
Exon (20)3436..3544
Gene:RECQL4
Gene Synonym:RECQ4
Exon (21)3545..3816
Gene:RECQL4
Gene Synonym:RECQ4
Translation MERLRDVRERLQAWERAFRRQRGRRPSQDDVEAAPEETRALYREYRTLKRTTGQAGGGLR SSESLPAAAEEAPEPRCWGPHLNRAATKSPQPTPGRSRQGSVPDYGQRLKANLKGTLQAG PALGRRPWPLGRASSKASTPKPPGTGPVPSFAEKVSDEPPQLPEPQPRPGRLQHLQASLS QRLGSLDPGWLQRCHSEVPDFLGAPKACRPDLGSEESQLLIPGESAVLGPGAGSQGPEAS AFQEVSIRVGSPQPSSSGGEKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAVEEDPPG EPVQAQPPQPCSSPSNPRYHGLSPSSQARAGKAEGTAPLHIFPRLARHDRGNYVRLNMKQ KHYVRGRALRSRLLRKQAWKQKWRKKGECFGGGGATVTTKESCFLNEQFDHWAAQCPRPA SEEDTDAVGPEPLVPSPQPVPEVPSLDPTVLPLYSLGPSGQLAETPAEVFQALEQLGHQA FRPGQERAVMRILSGISTLLVLPTGAGKSLCYQLPALLYSRRSPCLTLVVSPLLSLMDDQ VSGLPPCLKAACIHSGMTRKQRESVLQKIRAAQVHVLMLTPEALVGAGGLPPAAQLPPVA FACIDEAHCLSQWSHNFRPCYLRVCKVLRERMGVHCFLGLTATATRRTASDVAQHLAVAE EPDLHGPAPVPTNLHLSVSMDRDTDQALLTLLQGKRFQNLDSIIIYCNRREDTERIAALL RTCLHAAWVPGSGGRAPKTTAEAYHAGMCSRERRRVQRAFMQGQLRVVVATVAFGMGLDR PDVRAVLHLGLPPSFESYVQAVGRAGRDGQPAHCHLFLQPQGEDLRELRRHVHADSTDFL AVKRLVQRVFPACTCTCTRPPSEQEGAVGGERPVPKYPPQEAEQLSHQAAPGPRRVCMGH ERALPIQLTVQALDMPEEAIETLLCYLELHPHHWLELLATTYTHCRLNCPGGPAQLQALA HRCPPLAVCLAQQLPEDPGQGSSSVEFDMVKLVDSMGWELASVRRALCQLQWDHEPRTGV RRGTGVLVEFSELAFHLRSPGDLTAEEKDQICDFLYGRVQARERQALARLRRTFQAFHSV AFPSCGPCLEQQDEERSTRLKDLLGRYFEEEEGQEPGGMEDAQGPEPGQARLQDWEDQVR CDIRQFLSLRPEEKFSSRAVARIFHGIGSPCYPAQVYGQDRRFWRKYLHLSFHALVGLAT EELLQVAR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(6)-dbSNP:
complement(6)-c, adbSNP:35667555
complement(17..18)-, tdbSNP:35464170
complement(37)-t, cdbSNP:35827852
complement(46..47)-, adbSNP:35093233
complement(174)-dbSNP:
complement(174)-g, adbSNP:2306386
complement(203)-g, adbSNP:35198096
complement(254)-g, adbSNP:34642881
complement(316)-dbSNP:
complement(316)-t, cdbSNP:2721190
complement(317)-g, adbSNP:200516441
complement(342)-t, cdbSNP:34496005
complement(344)-g, adbSNP:62530445
complement(350)-g, adbSNP:199543866
complement(351)-g, adbSNP:4251688
complement(372)-t, cdbSNP:193091206
complement(427)-dbSNP:
complement(427)-g, adbSNP:201542692
complement(507)-g, cdbSNP:116137512
complement(556)-g, adbSNP:188859497
complement(585)-g, adbSNP:34159914
complement(607)-g, adbSNP:34371341
complement(646)-g, cdbSNP:61754062
complement(657)-g, cdbSNP:35639991
complement(688)-t, cdbSNP:201301365
complement(758)-g, adbSNP:146709578
complement(780)-t, cdbSNP:4244613
complement(797)-g, adbSNP:199773279
complement(819)-g, adbSNP:201571855
complement(843)-g, cdbSNP:4244612
complement(848)-g, adbSNP:137853231
complement(859)-g, adbSNP:34103564
complement(904)-t, cdbSNP:199706417
complement(907)-t, cdbSNP:200382712
complement(933)-t, cdbSNP:34700133
complement(943)-g, adbSNP:34633809
complement(1085)-t, cdbSNP:201763704
complement(1132)-t, cdbSNP:144637135
complement(1157)-g, cdbSNP:200097701
complement(1201)-dbSNP:
complement(1201)-t, cdbSNP:202043854
complement(1208)-, gtdbSNP:34134064
complement(1261)-t, cdbSNP:117670586
complement(1389)-dbSNP:
complement(1389)-g, adbSNP:200763671
complement(1390)-t, cdbSNP:200941778
complement(1437)-dbSNP:
complement(1437)-g, adbSNP:34948955
complement(1440)-t, cdbSNP:145615931
complement(1553)-dbSNP:
complement(1553)-t, gdbSNP:183852597
complement(1606)-t, cdbSNP:35407712
complement(1607)-g, adbSNP:35842750
complement(1618)-g, adbSNP:200732690
complement(1726)-dbSNP:
complement(1726)-g, adbSNP:61759892
complement(1736)-t, adbSNP:187220982
complement(1739)-g, adbSNP:201648505
complement(1814)-dbSNP:
complement(1814)-t, cdbSNP:2721191
complement(1815)-g, adbSNP:188065371
complement(1889)-t, cdbSNP:199654783
complement(1910)-t, cdbSNP:201734382
complement(1914)-g, adbSNP:201815449
complement(1996)-dbSNP:
complement(1996)-t, cdbSNP:61754061
complement(2008)-g, adbSNP:55667349
complement(2167)-dbSNP:
complement(2167)-g, adbSNP:199562131
complement(2186)-t, cdbSNP:184775551
complement(2265)-dbSNP:
complement(2265)-t, cdbSNP:34271972
complement(2268)-c, adbSNP:200002105
complement(2279)-g, adbSNP:201883228
complement(2280)-g, adbSNP:35215952
complement(2302)-g, adbSNP:193024188
complement(2303)-t, cdbSNP:190061994
complement(2311)-t, cdbSNP:137853229
complement(2419)-t, cdbSNP:35098923
complement(2421)-, tgdbSNP:56236695
complement(2437)-g, adbSNP:34293591
complement(2457)-t, cdbSNP:34735741
complement(2502)-g, adbSNP:202078917
complement(2552)-dbSNP:
complement(2552)-g, adbSNP:149067160
complement(2560)-g, adbSNP:201106179
complement(2586)-g, adbSNP:200114521
complement(2587)-t, cdbSNP:201661055
complement(2620..2621)-, gdbSNP:145431180
complement(2628)-t, cdbSNP:201012205
complement(2643)-g, cdbSNP:34358597
complement(2678)-t, gdbSNP:137975310
complement(2750)-g, adbSNP:150308387
complement(2797)-t, cdbSNP:186739072
complement(2859)-dbSNP:
complement(2859)-t, cdbSNP:202045203
complement(2932)-dbSNP:
complement(2932)-t, gdbSNP:33972310
complement(2968)-g, adbSNP:35070885
complement(2995)-t, cdbSNP:200629599
complement(3009)-t, cdbSNP:200018416
complement(3010)-t, cdbSNP:151223648
complement(3051)-g, adbSNP:34919378
complement(3052)-t, cdbSNP:36023964
complement(3056)-g, adbSNP:4251691
complement(3100)-dbSNP:
complement(3100)-t, cdbSNP:114149451
complement(3103)-t, cdbSNP:137853232
complement(3104)-g, adbSNP:34666647
complement(3169)-g, adbSNP:4925828
complement(3175)-g, adbSNP:35348691
complement(3185)-t, cdbSNP:202203322
complement(3198)-g, adbSNP:200530038
complement(3226)-g, adbSNP:199658221
complement(3313)-dbSNP:
complement(3313)-t, cdbSNP:137853230
complement(3355)-g, adbSNP:34915097
complement(3356)-g, adbSNP:36078464
complement(3359)-g, adbSNP:34236392
complement(3379)-g, cdbSNP:35101495
complement(3405)-g, adbSNP:148752485
complement(3434)-t, cdbSNP:201369291
complement(3466)-dbSNP:
complement(3466)-t, g, cdbSNP:61755067
complement(3472)-g, adbSNP:202134651
complement(3477)-g, cdbSNP:61755066
complement(3485)-t, cdbSNP:35346077
complement(3522)-g, adbSNP:34914400
complement(3537)-g, adbSNP:202083938
complement(3538..3539)-, cdbSNP:35626651
complement(3573)-dbSNP:
complement(3573)-g, adbSNP:139228543
complement(3615)-g, adbSNP:199885535
complement(3622)-c, adbSNP:201809411
complement(3636)-t, cdbSNP:146398243
complement(3642)-g, adbSNP:35225938
complement(3651)-g, adbSNP:201384843
complement(3664)-t, cdbSNP:41555416
complement(3666)-g, adbSNP:56341125
complement(3678)-g, adbSNP:55805048
complement(3680)-g, adbSNP:200068546
complement(3692)-t, cdbSNP:201586678
Gene SymbolRECQL4
Gene SynonymRECQ4
Chromosome8
Locus Map8q24.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004260 Homo sapiens RecQ protein-like 4 (RECQL4), mRNA. On-demand $1699.00 25
Title RAPADILINO RECQL4 mutant protein lacks helicase and ATPase activity .
Author Croteau,D.L., Rossi,M.L., Ross,J., Dawut,L., Dunn,C., Kulikowicz,T. and Bohr,V.A.
Journal Biochim. Biophys. Acta 1822 (11), 1727-1734 (2012)
Title RecQL4 cytoplasmic localization: implications in mitochondrial DNA oxidative damage repair .
Author Chi,Z., Nie,L., Peng,Z., Yang,Q., Yang,K., Tao,J., Mi,Y., Fang,X., Balajee,A.S. and Zhao,Y.
Journal Int. J. Biochem. Cell Biol. 44 (11), 1942-1951 (2012)
Title The N-terminus of the human RecQL4 helicase is a homeodomain-like .
Author Ohlenschlager,O., Kuhnert,A., Schneider,A., Haumann,S., Bellstedt,P., Keller,H., Saluz,H.P., Hortschansky,P., Hanel,F., Grosse,F., Gorlach,M. and Pospiech,H.
Journal Nucleic Acids Res. 40 (17), 8309-8324 (2012)
Title The human RecQ helicases BLM and RECQL4 cooperate to preserve genome stability .
Author Singh,D.K., Popuri,V., Kulikowicz,T., Shevelev,I., Ghosh,A.K., Ramamoorthy,M., Rossi,M.L., Janscak,P., Croteau,D.L. and Bohr,V.A.
Journal Nucleic Acids Res. 40 (14), 6632-6648 (2012)
Title The helicase domain and C-terminus of human RecQL4 facilitate replication elongation on DNA templates damaged by ionizing radiation .
Author Kohzaki,M., Chiourea,M., Versini,G., Adachi,N., Takeda,S., Gagos,S. and Halazonetis,T.D.
Journal Carcinogenesis 33 (6), 1203-1210 (2012)
Title Nuclear structure in normal and Bloom syndrome cells .
Author Yankiwski,V., Marciniak,R.A., Guarente,L. and Neff,N.F.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (10), 5214-5219 (2000)
Title Rothmund-thomson syndrome responsible gene, RECQL4: genomic structure and products .
Author Kitao,S., Lindor,N.M., Shiratori,M., Furuichi,Y. and Shimamoto,A.
Journal Genomics 61 (3), 268-276 (1999)
Title Mutations in RECQL4 cause a subset of cases of Rothmund-Thomson syndrome .
Author Kitao,S., Shimamoto,A., Goto,M., Miller,R.W., Smithson,W.A., Lindor,N.M. and Furuichi,Y.
Journal Nat. Genet. 22 (1), 82-84 (1999)
Title Cloning of two new human helicase genes of the RecQ family: biological significance of multiple species in higher eukaryotes .
Author Kitao,S., Ohsugi,I., Ichikawa,K., Goto,M., Furuichi,Y. and Shimamoto,A.
Journal Genomics 54 (3), 443-452 (1998)
Title Intrafusal fibre types in rat limb muscle spindles: morphological and histochemical characteristics .
Author Soukup,T.
Journal Histochemistry 47 (1), 43-57 (1976)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.