• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens carbohydrate (chondroitin 6) sulfotransferase 3 (CHST3), mRNA.


RefSeq Accession Definition Services Price Order
NM_004273 Homo sapiens carbohydrate (chondroitin 6) sulfotransferase 3 (CHST3), mRNA. ORF Sequence $417.60
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_004273.4, 224493825
Length 6978 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens carbohydrate (chondroitin 6) sulfotransferase 3 (CHST3), mRNA.
Product carbohydrate sulfotransferase 3
Comment

Summary: This gene encodes an enzyme which catalyzes the sulfation of chondroitin, a proteoglycan found in the extracellular matrix and most cells which is involved in cell migration and differentiation. Mutations in this gene are associated with spondylepiphyseal dysplasia and humerospinal dysostosis. [provided by RefSeq, Mar 2009].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_004264.2
CDS 441..1880
Misc Feature(1)378..380
Misc Feature(2)378..380
Misc Feature(3)501..554
Misc Feature(4)501..554
Misc Feature(5)<1245..1796
Exon (1)1..333
Gene:CHST3
Gene Synonym:C6ST; C6ST1; HSD
Exon (2)334..580
Gene:CHST3
Gene Synonym:C6ST; C6ST1; HSD
Exon (3)581..6973
Gene:CHST3
Gene Synonym:C6ST; C6ST1; HSD
Translation MEKGLTLPQDCRDFVHSLKMRSKYALFLVFVVIVFVFIEKENKIISRVSDKLKQIPQALA DANSTDPALILAENASLLSLSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKE EEPPRPAVAGPRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVSFEPGGAN AAGSALVYRDVLKQLFLCDLYVLEHFITPLPEDHLTQFMFRRGSSRSLCEDPVCTPFVKK VFEKYHCKNRRCGPLNVTLAAEACRRKEHMALKAVRIRQLEFLQPLAEDPRLDLRVIQLV RDPRAVLASRMVAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPA WLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDGSGIYSTQKN SSEQFEKWRFSMPFKLAQVVQAACGPAMRLFGYKLARDAAALTNRSVSLLEERGTFWVT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
83+dbSNP:
83+c, tdbSNP:182816275
147+c, gdbSNP:4148907
167+g, tdbSNP:146305825
390+a, gdbSNP:202050418
424+c, tdbSNP:191007783
447+a, gdbSNP:199515173
474+c, tdbSNP:140377563
548+c, gdbSNP:77124584
615+dbSNP:
615+c, tdbSNP:140362604
617+a, gdbSNP:200494658
642+a, gdbSNP:142556853
708+c, tdbSNP:146344177
709+c, tdbSNP:138203946
719+c, tdbSNP:149569616
736+c, tdbSNP:144218298
747+a, gdbSNP:201211046
751+a, gdbSNP:148801316
788+g, tdbSNP:144885813
826+c, gdbSNP:147535559
857+c, tdbSNP:144287889
862+c, tdbSNP:267606735
905+c, gdbSNP:200547164
906+a, gdbSNP:202107912
915+a, tdbSNP:145538723
921+c, tdbSNP:267606733
967+c, gdbSNP:201963050
971+c, gdbSNP:150965438
1001+c, gdbSNP:147804585
1037+a, cdbSNP:149671252
1043+a, cdbSNP:121908619
1064+a, gdbSNP:145440508
1104+c, tdbSNP:121908617
1197+a, gdbSNP:200988207
1216+c, tdbSNP:121908616
1268+c, tdbSNP:140547825
1297+c, tdbSNP:121908620
1351+a, gdbSNP:28937593
1360+c, tdbSNP:121908618
1428+c, tdbSNP:267606732
1443+a, gdbSNP:150466838
1484+c, gdbSNP:3740128
1510+a, gdbSNP:3740129
1554+a, gdbSNP:267606734
1600+a, gdbSNP:145384892
1613+a, cdbSNP:115579748
1637+c, tdbSNP:184636110
1691+c, gdbSNP:140411224
1787+c, tdbSNP:200249458
1793+c, tdbSNP:76803307
1868+c, tdbSNP:75845750
1887+c, tdbSNP:202242499
1926+a, gdbSNP:189400876
1946+g, tdbSNP:55939908
2044+, tdbSNP:11306241
2048+a, gdbSNP:182175534
2083+a, gdbSNP:77359818
2135+c, tdbSNP:114569872
2154+c, tdbSNP:116508900
2170+c, gdbSNP:184330297
2226+c, tdbSNP:76094341
2277+g, tdbSNP:138805155
2286+a, gdbSNP:80210009
2363+a, gdbSNP:113283291
2382+c, tdbSNP:75166049
2403+a, gdbSNP:189173490
2441+a, gdbSNP:181113786
2470+a, gdbSNP:141983962
2513+c, tdbSNP:185445266
2590+a, gdbSNP:190298233
2643+a, cdbSNP:4148941
2656+a, gdbSNP:115478548
2689+c, tdbSNP:145689465
2735+a, cdbSNP:181471425
2736+c, gdbSNP:186004202
2886+c, tdbSNP:116018996
2889+c, tdbSNP:190763138
2901..2902+, tdbSNP:34158877
2968+a, g, tdbSNP:115617050
2970+g, tdbSNP:148125052
2981+g, tdbSNP:116999241
3010+c, gdbSNP:4148942
3034..3035+, gdbSNP:34828900
3036+c, gdbSNP:4747236
3064+c, gdbSNP:187692473
3158+c, tdbSNP:4148943
3194+a, gdbSNP:4148944
3225+g, tdbSNP:201456562
3241+c, tdbSNP:4148945
3250+a, gdbSNP:60924680
3305+c, tdbSNP:80269486
3306+c, tdbSNP:76062174
3327+a, cdbSNP:76808415
3402+a, tdbSNP:150772968
3488..3489+, tdbSNP:200563439
3703+c, gdbSNP:116289781
3724+c, tdbSNP:4148946
3768+c, tdbSNP:4148947
3779+a, gdbSNP:17297481
3857..3858+, gtdbSNP:150678709
3869+c, tdbSNP:190743499
3906+a, gdbSNP:115545740
4006+a, cdbSNP:7072219
4043+a, gdbSNP:114563668
4045+a, cdbSNP:112797457
4050+g, tdbSNP:79099269
4229+a, c, gdbSNP:4148948
4271+c, tdbSNP:116391584
4302+c, tdbSNP:4148949
4344+c, gdbSNP:117578356
4348+a, gdbSNP:183032812
4390+c, gdbSNP:139186201
4440+c, tdbSNP:187078225
4471+a, tdbSNP:191889682
4540+c, tdbSNP:143743853
4598+a, gdbSNP:115489836
4623+a, gdbSNP:147227559
4706+a, gdbSNP:114457501
4720+a, gdbSNP:140272473
4735+c, tdbSNP:144248670
4778+g, tdbSNP:182900996
4902+a, tdbSNP:145507314
4919+c, tdbSNP:74145519
4933+c, tdbSNP:12172746
4970+a, tdbSNP:76750860
5009+c, gdbSNP:187587634
5172+c, tdbSNP:148431635
5181+a, gdbSNP:75962504
5186+a, gdbSNP:12250549
5247+c, tdbSNP:193204538
5325+a, gdbSNP:185581202
5357+a, gdbSNP:4148950
5398+c, gdbSNP:142898283
5435+a, gdbSNP:4148951
5445+a, gdbSNP:151095465
5546+a, gdbSNP:113342172
5581..5582+, agdbSNP:200054447
5665+a, gdbSNP:1871450
5764+a, gdbSNP:77908871
5770+c, tdbSNP:79559408
5771+a, gdbSNP:79037746
5806+c, gdbSNP:190807630
5812+g, tdbSNP:1871451
5867+a, gdbSNP:56218110
5929+a, cdbSNP:192320139
5975+a, gdbSNP:114800040
5987+c, tdbSNP:731027
6180+a, gdbSNP:141062797
6221+a, cdbSNP:12267478
6239+a, gdbSNP:145151652
6301+c, gdbSNP:730722
6312+a, tdbSNP:1871452
6330+c, gdbSNP:183731077
6375+c, tdbSNP:730721
6388+c, tdbSNP:146892467
6413+a, gdbSNP:730720
6513+g, tdbSNP:117714459
6650+a, gdbSNP:4148953
6665+a, gdbSNP:12418
6745+c, tdbSNP:140500823
6954+c, tdbSNP:188494077
6957+a, cdbSNP:71479428
6958+a, gdbSNP:145644739
Gene SymbolCHST3
Gene SynonymC6ST; C6ST1; HSD
Chromosome10
Locus Map10q22.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_004273 Homo sapiens carbohydrate (chondroitin 6) sulfotransferase 3 (CHST3), mRNA. Full Length $3140.10
ORF Sequence $417.60
Title Persistent cortical plasticity by upregulation of chondroitin 6-sulfation .
Author Miyata,S., Komatsu,Y., Yoshimura,Y., Taya,C. and Kitagawa,H.
Journal Nat. Neurosci. 15 (3), 414-422 (2012)
Title Phenotypic features of carbohydrate sulfotransferase 3 (CHST3) deficiency in 24 patients: congenital dislocations and vertebral changes as principal diagnostic features .
Author Unger,S., Lausch,E., Rossi,A., Megarbane,A., Sillence,D., Alcausin,M., Aytes,A., Mendoza-Londono,R., Nampoothiri,S., Afroze,B., Hall,B., Lo,I.F., Lam,S.T., Hoefele,J., Rost,I., Wakeling,E., Mangold,E., Godbole,K., Vatanavicharn,N., Franco,L.M., Chandler,K., Hollander,S., Velten,T., Reicherter,K., Spranger,J., Robertson,S., Bonafe,L., Zabel,B. and Superti-Furga,A.
Journal Am. J. Med. Genet. A 152A (10), 2543-2549 (2010)
Title Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects .
Author Saito,A., Kawamoto,M. and Kamatani,N.
Journal J. Hum. Genet. 54 (6), 317-323 (2009)
Title Omani-type spondyloepiphyseal dysplasia with cardiac involvement caused by a missense mutation in CHST3 .
Author Tuysuz,B., Mizumoto,S., Sugahara,K., Celebi,A., Mundlos,S. and Turkmen,S.
Journal Clin. Genet. 75 (4), 375-383 (2009)
Title Sulfation of the galactose residues in the glycosaminoglycan-protein linkage region by recombinant human chondroitin 6-O-sulfotransferase-1 .
Author Kitagawa,H., Tsutsumi,K., Ikegami-Kuzuhara,A., Nadanaka,S., Goto,F., Ogawa,T. and Sugahara,K.
Journal J. Biol. Chem. 283 (41), 27438-27443 (2008)
Title Loss of chondroitin 6-O-sulfotransferase-1 function results in severe human chondrodysplasia with progressive spinal involvement .
Author Thiele,H., Sakano,M., Kitagawa,H., Sugahara,K., Rajab,A., Hohne,W., Ritter,H., Leschik,G., Nurnberg,P. and Mundlos,S.
Journal Proc. Natl. Acad. Sci. U.S.A. 101 (27), 10155-10160 (2004)
Title Functional analysis of the chondroitin 6-sulfotransferase gene in relation to lymphocyte subpopulations, brain development, and oversulfated chondroitin sulfates .
Author Uchimura,K., Kadomatsu,K., Nishimura,H., Muramatsu,H., Nakamura,E., Kurosawa,N., Habuchi,O., El-Fasakhany,F.M., Yoshikai,Y. and Muramatsu,T.
Journal J. Biol. Chem. 277 (2), 1443-1450 (2002)
Title Molecular cloning, expression, and chromosomal mapping of human chondroitin 4-sulfotransferase, whose expression pattern in human tissues is different from that of chondroitin 6-sulfotransferase .
Author Okuda,T., Mita,S., Yamauchi,S., Matsubara,T., Yagi,F., Yamamori,D., Fukuta,M., Kuroiwa,A., Matsuda,Y. and Habuchi,O.
Journal J. Biochem. 128 (5), 763-770 (2000)
Title Functional expression and genomic structure of human chondroitin 6-sulfotransferase .
Author Tsutsumi,K., Shimakawa,H., Kitagawa,H. and Sugahara,K.
Journal FEBS Lett. 441 (2), 235-241 (1998)
Title Molecular cloning and expression of human chondroitin 6-sulfotransferase .
Author Fukuta,M., Kobayashi,Y., Uchimura,K., Kimata,K. and Habuchi,O.
Journal Biochim. Biophys. Acta 1399 (1), 57-61 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878