• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens BCL2-associated athanogene 3 (BAG3), mRNA.


RefSeq Accession Definition Services Price Order
NM_004281 Homo sapiens BCL2-associated athanogene 3 (BAG3), mRNA. ORF Sequence $501.12
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_004281.3, 62530382
Length 2608 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens BCL2-associated athanogene 3 (BAG3), mRNA.
Product BAG family molecular chaperone regulator 3
Comment

Summary: BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The protein encoded by this gene contains a WW domain in the N-terminal region and a BAG domain in the C-terminal region. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner. [provided by RefSeq, Jul 2008].

RefSeq NP_004272.2
CDS 307..2034
Misc Feature(1)310..312
Misc Feature(2)310..312
Misc Feature(3)373..465
Misc Feature(4)order(418..420,451..453)
Misc Feature(5)817..819
Misc Feature(6)898..900
Misc Feature(7)1024..1026
Misc Feature(8)1045..1047
Misc Feature(9)1096..1098
Misc Feature(10)1126..1128
Misc Feature(11)1126..1128
Misc Feature(12)1129..1131
Misc Feature(13)1129..1131
Misc Feature(14)1141..1143
Misc Feature(15)1141..1143
Misc Feature(16)1153..1155
Misc Feature(17)1159..1161
Misc Feature(18)1159..1161
Misc Feature(19)1171..1173
Misc Feature(20)1171..1173
Misc Feature(21)1177..1179
Misc Feature(22)1435..1437
Misc Feature(23)1435..1437
Misc Feature(24)1435..1437
Misc Feature(25)1447..1449
Misc Feature(26)1462..1464
Misc Feature(27)1462..1464
Misc Feature(28)1522..1524
Misc Feature(29)1576..1800
Exon (1)1..486
Gene:BAG3
Gene Synonym:BAG-3; BIS; CAIR-1
Exon (2)487..813
Gene:BAG3
Gene Synonym:BAG-3; BIS; CAIR-1
Exon (3)814..1215
Gene:BAG3
Gene Synonym:BAG-3; BIS; CAIR-1
Exon (4)1216..2571
Gene:BAG3
Gene Synonym:BAG-3; BIS; CAIR-1
Translation MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPK ETPSSANGPSREGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQ RFRTEAAAAAPQRSQSPLRGMPETTQPDKQCGQVAAAAAAQPPASHGPERSQSPAASDCS SSSSSASLPSSGRSSLGSHQLPRGYISIPVIHEQNVTRPAAQPSFHQAQKTHYPAQQGEY QTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSPARSSTPLHSPSPIRVHTVVD RPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSKPVSQKPPPPSE KVEVKVPPAPVPCPPPSPGPSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHP GVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQAR RDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAG NAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
23+dbSNP:
23+c, gdbSNP:192502283
36+c, tdbSNP:144814361
39+c, tdbSNP:2736419
41+c, tdbSNP:2736420
212+a, gdbSNP:111750619
216+a, gdbSNP:185840368
290+a, gdbSNP:200388926
331+a, gdbSNP:137965903
380+g, tdbSNP:142391650
408+c, gdbSNP:145934400
409+a, gdbSNP:200072558
434+a, cdbSNP:201329879
479+g, tdbSNP:138785335
480+c, tdbSNP:141858419
487+dbSNP:
487+a, gdbSNP:187116556
493+c, gdbSNP:144041999
518+c, tdbSNP:35434411
536+c, tdbSNP:141355480
537+a, gdbSNP:143752613
555+a, cdbSNP:151331972
586+a, tdbSNP:145393807
612+c, tdbSNP:202006167
674+a, gdbSNP:199991063
687+a, tdbSNP:140594879
697+c, gdbSNP:140672627
738+a, cdbSNP:144928892
757+c, tdbSNP:2234962
769+a, gdbSNP:61756328
771..772+, gcgdbSNP:139438727
777+a, gdbSNP:148985314
782+, ggcdbSNP:78426039
800+c, tdbSNP:143756613
801+a, gdbSNP:35261472
804+c, tdbSNP:111682654
814+dbSNP:
814+c, tdbSNP:200479768
815+a, gdbSNP:140904592
855+c, gdbSNP:112929734
880+a, gdbSNP:201487919
912+g, tdbSNP:74157690
920+a, tdbSNP:141497285
922+a, gdbSNP:199700646
932+c, tdbSNP:121918312
933+a, gdbSNP:188555685
942+c, tdbSNP:150379892
951+c, tdbSNP:138078305
952+a, g, tdbSNP:148282376
959+a, gdbSNP:201638005
985+c, gdbSNP:149517238
999+a, gdbSNP:144034433
1011+a, gdbSNP:141328836
1021+a, gdbSNP:148544471
1077+c, tdbSNP:200212999
1078+c, tdbSNP:117671123
1101+a, gdbSNP:180736121
1127+c, tdbSNP:143919208
1139+a, gdbSNP:200232102
1161+a, gdbSNP:147259596
1176+c, gdbSNP:140737221
1186+c, tdbSNP:144585878
1187+a, gdbSNP:151335530
1194+c, tdbSNP:139399890
1198+a, gdbSNP:150048651
1204+a, gdbSNP:78439745
1210+c, gdbSNP:199677021
1211+c, tdbSNP:201416791
1308+dbSNP:
1308+g, tdbSNP:3858339
1335+a, cdbSNP:117972572
1340+a, tdbSNP:189646603
1380+c, tdbSNP:201979259
1391+c, tdbSNP:200812717
1444+c, tdbSNP:144692954
1446+g, tdbSNP:201449869
1469+a, gdbSNP:146684783
1472+a, gdbSNP:140251789
1478+c, tdbSNP:200242752
1490+a, gdbSNP:111787446
1520+c, tdbSNP:11199064
1526+c, tdbSNP:3858340
1542+a, gdbSNP:113856701
1545+c, tdbSNP:201137108
1546+a, gdbSNP:117749531
1602+a, gdbSNP:196295
1627+a, gdbSNP:201181493
1723+c, gdbSNP:199682693
1724+a, gdbSNP:150156178
1729+a, gdbSNP:138832242
1742+a, gdbSNP:34656239
1809+a, cdbSNP:147277075
1860+a, tdbSNP:139125612
1893+c, tdbSNP:149358702
1894+a, gdbSNP:144678100
1911+c, tdbSNP:200427679
1939..1940+, cdbSNP:34165294
1941+c, gdbSNP:148597097
1963..1964+, gdbSNP:34008271
1963+a, gdbSNP:79949996
1979+c, tdbSNP:185537639
1980+a, gdbSNP:142981190
1986+a, gdbSNP:111920656
2004+a, gdbSNP:199837016
2065+c, tdbSNP:116329258
2126+g, tdbSNP:111435244
2195+a, gdbSNP:189488870
2219+a, gdbSNP:112913322
2252+c, gdbSNP:8946
2272..2274+, ttgdbSNP:145901315
2272+, ttgdbSNP:71758126
2274..2276+, gttdbSNP:10533360
2274+, gttdbSNP:3981124
2336+a, tdbSNP:113733053
2337..2338+, ctdbSNP:201877964
2338..2339+, ttdbSNP:59447464
2338+, ttdbSNP:71708187
2341..2342+, tgdbSNP:200363755
2353+c, tdbSNP:148967962
2536+a, tdbSNP:181519469
2569+a, gdbSNP:11199065
Gene SymbolBAG3
Gene SynonymBAG-3; BIS; CAIR-1
Chromosome10
Locus Map10q25.2-q26.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_004281 Homo sapiens BCL2-associated athanogene 3 (BAG3), mRNA. Full Length $756.32
ORF Sequence $501.12
Title Cellular mechanotransduction relies on tension-induced and chaperone-assisted autophagy .
Author Ulbricht,A., Eppler,F.J., Tapia,V.E., van der Ven,P.F., Hampe,N., Hersch,N., Vakeel,P., Stadel,D., Haas,A., Saftig,P., Behrends,C., Furst,D.O., Volkmer,R., Hoffmann,B., Kolanus,W. and Hohfeld,J.
Journal Curr. Biol. 23 (5), 430-435 (2013)
Title Expression of the antiapoptotic protein BAG3 is a feature of pancreatic adenocarcinoma and its overexpression is associated with poorer survival .
Author Rosati,A., Bersani,S., Tavano,F., Dalla Pozza,E., De Marco,M., Palmieri,M., De Laurenzi,V., Franco,R., Scognamiglio,G., Palaia,R., Fontana,A., di Sebastiano,P., Donadelli,M., Dando,I., Medema,J.P., Dijk,F., Welling,L., di Mola,F.F., Pezzilli,R., Turco,M.C. and Scarpa,A.
Journal Am. J. Pathol. 181 (5), 1524-1529 (2012)
Title BAG3 mutations: another cause of giant axonal neuropathy .
Author Jaffer,F., Murphy,S.M., Scoto,M., Healy,E., Rossor,A.M., Brandner,S., Phadke,R., Selcen,D., Jungbluth,H., Muntoni,F. and Reilly,M.M.
Journal J. Peripher. Nerv. Syst. 17 (2), 210-216 (2012)
Title NF-kappaB regulates protein quality control after heat stress through modulation of the BAG3-HspB8 complex .
Author Nivon,M., Abou-Samra,M., Richet,E., Guyot,B., Arrigo,A.P. and Kretz-Remy,C.
Journal J. Cell. Sci. 125 (PT 5), 1141-1151 (2012)
Title Bag3-induced autophagy is associated with degradation of JCV oncoprotein, T-Ag .
Author Sariyer,I.K., Merabova,N., Patel,P.K., Knezevic,T., Rosati,A., Turco,M.C. and Khalili,K.
Journal PLoS ONE 7 (9), E45000 (2012)
Title Protein-protein interaction panel using mouse full-length cDNAs .
Author Suzuki,H., Fukunishi,Y., Kagawa,I., Saito,R., Oda,H., Endo,T., Kondo,S., Bono,H., Okazaki,Y. and Hayashizaki,Y.
Journal Genome Res. 11 (10), 1758-1765 (2001)
Title The anti-apoptotic protein BAG-3 is overexpressed in pancreatic cancer and induced by heat stress in pancreatic cancer cell lines .
Author Liao,Q., Ozawa,F., Friess,H., Zimmermann,A., Takayama,S., Reed,J.C., Kleeff,J. and Buchler,M.W.
Journal FEBS Lett. 503 (2-3), 151-157 (2001)
Title CAIR-1/BAG-3 forms an EGF-regulated ternary complex with phospholipase C-gamma and Hsp70/Hsc70 .
Author Doong,H., Price,J., Kim,Y.S., Gasbarre,C., Probst,J., Liotta,L.A., Blanchette,J., Rizzo,K. and Kohn,E.
Journal Oncogene 19 (38), 4385-4395 (2000)
Title Bis, a Bcl-2-binding protein that synergizes with Bcl-2 in preventing cell death .
Author Lee,J.H., Takahashi,T., Yasuhara,N., Inazawa,J., Kamada,S. and Tsujimoto,Y.
Journal Oncogene 18 (46), 6183-6190 (1999)
Title An evolutionarily conserved family of Hsp70/Hsc70 molecular chaperone regulators .
Author Takayama,S., Xie,Z. and Reed,J.C.
Journal J. Biol. Chem. 274 (2), 781-786 (1999)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878