• THAT   AND
  • THAT   AND


Homo sapiens cathelicidin antimicrobial peptide (CAMP), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_004345 Homo sapiens cathelicidin antimicrobial peptide (CAMP), mRNA. Full Lenth $214.31
ORF Sequence $159.00
RefSeq Version NM_004345.3, 39753969
Length 739 bp
Structure linear
Update Date 27-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens cathelicidin antimicrobial peptide (CAMP), mRNA.
Product cathelicidin antimicrobial peptide
Comment

Summary: Cathelicidin antimicrobial protein is an antimicrobial protein found in specific granules of polymorphonuclear leukocytes (PMNs).[supplied by OMIM].

RefSeq NP_004336.2
CDS 141..653
Exon (1)1..341
Exon (2)1..341
Exon (3)342..449
Exon (4)450..521
Exon (5)522..714
Translation MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLD LDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGS FDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
82+c, gdbSNP:116581774
422+a, gdbSNP:112279864
485..491+, ccaggccdbSNP:56122065
522+g, tdbSNP:55988294
574+a, gdbSNP:55708841
Gene SymbolCAMP
Gene SynonymCAP-18; CAP18; CRAMP; FALL-39; FALL39; HSD26; LL37
Chromosome3
Locus Map3p21.3
All Transcripts NM_004345
Title PPARgamma mediates innate immunity by regulating the 1alpha,25-dihydroxyvitamin D3 induced hBD-3 and cathelicidin in human keratinocytes .
Author Dai,X., Sayama,K., Tohyama,M., Shirakata,Y., Hanakawa,Y., Tokumaru,S., Yang,L., Hirakawa,S. and Hashimoto,K.
Journal J. Dermatol. Sci. 60 (3), 179-186 (2010)
Title Increased serum leucine, leucine-37 levels in psoriasis: positive and negative feedback loops of leucine, leucine-37 and pro- or anti-inflammatory cytokines .
Author Kanda,N., Ishikawa,T., Kamata,M., Tada,Y. and Watanabe,S.
Journal Hum. Immunol. 71 (12), 1161-1171 (2010)
Title Antimicrobial activities of LL-37 and its truncated variants against Burkholderia thailandensis .
Author Kanthawong,S., Bolscher,J.G., Veerman,E.C., van Marle,J., Nazmi,K., Wongratanacheewin,S. and Taweechaisupapong,S.
Journal Int. J. Antimicrob. Agents 36 (5), 447-452 (2010)
Title Expression of antimicrobial peptides such as LL-37 and hBD-2 in nonlesional skin of atopic individuals .
Author Goo,J., Ji,J.H., Jeon,H., Kim,M.J., Jeon,S.Y., Cho,M.Y., Lee,S.H. and Choi,E.H.
Journal Pediatr Dermatol 27 (4), 341-348 (2010)
Title Uropathogenic Escherichia coli modulates immune responses and its curli fimbriae interact with the antimicrobial peptide LL-37 .
Author Kai-Larsen,Y., Luthje,P., Chromek,M., Peters,V., Wang,X., Holm,A., Kadas,L., Hedlund,K.O., Johansson,J., Chapman,M.R., Jacobson,S.H., Romling,U., Agerberth,B. and Brauner,A.
Journal PLoS Pathog. 6 (7), E1001010 (2010)
Title The human gene FALL39 and processing of the cathelin precursor to the antibacterial peptide LL-37 in granulocytes .
Author Gudmundsson,G.H., Agerberth,B., Odeberg,J., Bergman,T., Olsson,B. and Salcedo,R.
Journal Eur. J. Biochem. 238 (2), 325-332 (1996)
Title Structure of the gene for porcine peptide antibiotic PR-39, a cathelin gene family member: comparative mapping of the locus for the human peptide antibiotic FALL-39 .
Author Gudmundsson,G.H., Magnusson,K.P., Chowdhary,B.P., Johansson,M., Andersson,L. and Boman,H.G.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (15), 7085-7089 (1995)
Title hCAP-18, a cathelin/pro-bactenecin-like protein of human neutrophil specific granules .
Author Cowland,J.B., Johnsen,A.H. and Borregaard,N.
Journal FEBS Lett. 368 (1), 173-176 (1995)
Title Human CAP18: a novel antimicrobial lipopolysaccharide-binding protein .
Author Larrick,J.W., Hirata,M., Balint,R.F., Lee,J., Zhong,J. and Wright,S.C.
Journal Infect. Immun. 63 (4), 1291-1297 (1995)
Title FALL-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone marrow and testis .
Author Agerberth,B., Gunne,H., Odeberg,J., Kogner,P., Boman,H.G. and Gudmundsson,G.H.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (1), 195-199 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878