• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu21636 Homo sapiens CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu21636C Homo sapiens CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA), transcript variant 1, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_004364.4, 551894987
Length 1077 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA), transcript variant 1, mRNA.
Product CCAAT/enhancer-binding protein alpha isoform a
Comment

Summary: This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain and recognizes the CCAAT motif in the promoters of target genes. The encoded protein functions in homodimers and also heterodimers with CCAAT/enhancer-binding proteins beta and gamma. Activity of this protein can modulate the expression of genes involved in cell cycle regulation as well as in body weight homeostasis. Mutation of this gene is associated with acute myeloid leukemia. The use of alternative in-frame non-AUG (GUG) and AUG start codons results in protein isoforms with different lengths. Differential translation initiation is mediated by an out-of-frame, upstream open reading frame which is located between the GUG and the first AUG start codons. [provided by RefSeq, Dec 2013].


Transcript Variant: This variant (1) can initiate translation from an upstream non-AUG (GUG) site, and also from three downstream, in-frame AUG sites. The isoform (a, also known as C/EBP-42) represented in this RefSeq results from translation initiation at the first AUG start codon. Isoform a has a shorter N-terminus, compared to isoform c.


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_004355.2
CDS 151..1227
Misc Feature(1)46..48
Misc Feature(2)126..143
Misc Feature(3)193..195
Misc Feature(4)193..195
Misc Feature(5)508..510
Misc Feature(6)631..633
Misc Feature(7)631..633
Misc Feature(8)826..828
Misc Feature(9)838..840
Misc Feature(10)850..852
Misc Feature(11)1006..1089
Misc Feature(12)1012..1158
Misc Feature(13)order(1015..1017,1024..1029,1036..1041,1048..1050)
Misc Feature(14)1099..1185
Exon (1)1..2631
Gene:CEBPA
Gene Synonym:C/EBP-alpha; CEBP
Translation MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVM PGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP YQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPA LGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(41)-dbSNP:
complement(41)-g, adbSNP:41480346
complement(112)-t, gdbSNP:41434054
218..219+, cdbSNP:137852729
218+, cdbSNP:137852728
complement(231)-g, cdbSNP:111662895
291+, cdbSNP:137852730
298+g, tdbSNP:121912791
351..352+, ctacdbSNP:137852731
367..368+, cdbSNP:137852733
401+a, tdbSNP:28931590
469..470+, tgdbSNP:137852732
complement(723)-g, adbSNP:192240793
840+g, tdbSNP:34529039
863+a, cdbSNP:3745972
904+g, tdbSNP:1049967
complement(977)-t, cdbSNP:201061067
complement(1002)-t, cdbSNP:376856647
complement(1032)-g, adbSNP:376093748
complement(1050)-g, cdbSNP:369123206
complement(1059)-g, adbSNP:371444741
complement(1092)-c, adbSNP:377329266
complement(1140)-t, cdbSNP:375876732
complement(1150)-g, cdbSNP:369632687
complement(1168)-t, cdbSNP:375833261
complement(1171)-t, cdbSNP:372931505
complement(1191)-t, cdbSNP:141430731
complement(1191)-g, adbSNP:386474461
complement(1201)-g, cdbSNP:373210526
complement(1232)-g, adbSNP:375735989
complement(1245)-g, adbSNP:371719077
complement(1247)-c, adbSNP:148740083
complement(1296)-t, cdbSNP:376092627
complement(1372)-c, adbSNP:187751931
complement(1389)-g, adbSNP:184965384
1529+c, tdbSNP:4142943
complement(1588)-t, cdbSNP:41367646
complement(1664)-g, adbSNP:1049969
complement(1806)-g, adbSNP:192371350
1822+c, tdbSNP:2376497
complement(1832)-g, adbSNP:372919877
complement(1942)-g, cdbSNP:707656
complement(2051)-c, adbSNP:376667577
complement(2221)-t, adbSNP:187516157
complement(2232)-g, adbSNP:146104564
complement(2260)-t, cdbSNP:34017519
complement(2313)-g, adbSNP:113670631
complement(2344)-t, cdbSNP:12691
complement(2354)-c, adbSNP:116528776
complement(2543)-g, cdbSNP:35196724
Gene SymbolCEBPA
Gene SynonymC/EBP-alpha; CEBP
Chromosome19
Locus Map19q13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004364 Homo sapiens CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA), transcript variant 1, mRNA. On-demand TBD TBD
NM_001287435 Homo sapiens CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA), transcript variant 1, mRNA. On-demand TBD TBD
NM_001287424 Homo sapiens CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA), transcript variant 1, mRNA. On-demand TBD TBD
NM_001285829 Homo sapiens CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA), transcript variant 1, mRNA. On-demand TBD TBD
Title CCAAT/enhancer binding protein-mediated regulation of TGFbeta receptor 2 expression determines the hepatoblast fate decision .
Author Takayama K, Kawabata K, Nagamoto Y, Inamura M, Ohashi K, Okuno H, Yamaguchi T, Tashiro K, Sakurai F, Hayakawa T, Okano T, Furue MK and Mizuguchi H.
Journal Development 141 (1), 91-100 (2014)
Title Sox4 is a key oncogenic target in C/EBPalpha mutant acute myeloid leukemia .
Author Zhang H, Alberich-Jorda M, Amabile G, Yang H, Staber PB, Di Ruscio A, Welner RS, Ebralidze A, Zhang J, Levantini E, Lefebvre V, Valk PJ, Delwel R, Hoogenkamp M, Nerlov C, Cammenga J, Saez B, Scadden DT, Bonifer C, Ye M and Tenen DG.
Journal Cancer Cell 24 (5), 575-588 (2013)
Title Nucleolar retention of a translational C/EBPalpha isoform stimulates rDNA transcription and cell size .
Author Muller C, Bremer A, Schreiber S, Eichwald S and Calkhoven CF.
Journal EMBO J. 29 (5), 897-909 (2010)
Title Translational control of C/EBPalpha and C/EBPbeta isoform expression .
Author Calkhoven CF, Muller C and Leutz A.
Journal Genes Dev. 14 (15), 1920-1932 (2000)
Title Transcription factor C/EBPalpha: novel sites of expression and cloning of the human gene .
Author Swart GW, van Groningen JJ, van Ruissen F, Bergers M and Schalkwijk J.
Journal Biol. Chem. 378 (5), 373-379 (1997)
Title Molecular cloning, sequence, and expression patterns of the human gene encoding CCAAT/enhancer binding protein alpha (C/EBP alpha) .
Author Antonson P and Xanthopoulos KG.
Journal Biochem. Biophys. Res. Commun. 215 (1), 106-113 (1995)
Title A 30-kDa alternative translation product of the CCAAT/enhancer binding protein alpha message: transcriptional activator lacking antimitotic activity .
Author Lin FT, MacDougald OA, Diehl AM and Lane MD.
Journal Proc. Natl. Acad. Sci. U.S.A. 90 (20), 9606-9610 (1993)
Title CCAAT/enhancer-binding protein mRNA is translated into multiple proteins with different transcription activation potentials .
Author Ossipow V, Descombes P and Schibler U.
Journal Proc. Natl. Acad. Sci. U.S.A. 90 (17), 8219-8223 (1993)
Title Familial Acute Myeloid Leukemia (AML) with Mutated CEBPA .
Author Klein,R.D. and Marcucci,G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title The CCAAT/enhancer binding protein (C/EBP alpha) gene (CEBPA) maps to human chromosome 19q13.1 and the related nuclear factor NF-IL6 (C/EBP beta) gene (CEBPB) maps to human chromosome 20q13.1 .
Author Hendricks-Taylor LR, Bachinski LL, Siciliano MJ, Fertitta A, Trask B, de Jong PJ, Ledbetter DH and Darlington GJ.
Journal Genomics 14 (1), 12-17 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.