• THAT   AND
  • THAT   AND


Homo sapiens CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_004364 Homo sapiens CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA), mRNA. Full Lenth $751.39
ORF Sequence $312.33


RefSeq Version NM_004364.3, 225735576
Length 2591 bp
Structure linear
Update Date 21-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA), mRNA.
Product CCAAT/enhancer-binding protein alpha
Comment

Summary: The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain promoters and enhancers. It can also form heterodimers with the related proteins CEBP-beta and CEBP-gamma. The encoded protein has been shown to bind to the promoter and modulate the expression of the gene encoding leptin, a protein that plays an important role in body weight homeostasis. Also, the encoded protein can interact with CDK2 and CDK4, thereby inhibiting these kinases and causing growth arrest in cultured cells. [provided by RefSeq].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_004355.2
CDS 111..1187
Exon (1)1..2591
Exon (2)1..2591
Translation MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVM PGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP YQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPA LGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(1)-g, adbSNP:41480346
complement(72)-t, gdbSNP:41434054
178..179+, cdbSNP:137852729
178+, cdbSNP:137852728
complement(191)-g, cdbSNP:111662895
251+, cdbSNP:137852730
311..312+, ctacdbSNP:137852731
327..328+, cdbSNP:137852733
361+a, tdbSNP:28931590
429..430+, tgdbSNP:137852732
800+g, tdbSNP:34529039
823+a, cdbSNP:3745972
864+g, tdbSNP:1049967
1489+c, tdbSNP:4142943
complement(1548)-t, cdbSNP:41367646
1624+a, gdbSNP:1049969
1782+c, tdbSNP:2376497
1902+c, gdbSNP:707656
complement(1997)-c, adbSNP:79346216
complement(2067)-g, adbSNP:117824223
complement(2126)-g, adbSNP:79620653
2220+c, tdbSNP:34017519
complement(2273)-g, adbSNP:113670631
2304+c, tdbSNP:12691
complement(2314)-c, adbSNP:116528776
2503+c, gdbSNP:35196724
Gene SymbolCEBPA
Gene SynonymC/EBP-alpha; CEBP
Chromosome19
Locus Map19q13.1
All Transcripts NM_004364
Title Combined testing for CCAAT/enhancer-binding protein alpha (CEBPA) mutations and promoter methylation in acute myeloid leukemia demonstrates shared phenotypic features .
Author Szankasi,P., Ho,A.K., Bahler,D.W., Efimova,O. and Kelley,T.W.
Journal Leuk. Res. 35 (2), 200-207 (2011)
Title CEBPA methylation as a prognostic biomarker in patients with de novo acute myeloid leukemia .
Author Lin,T.C., Hou,H.A., Chou,W.C., Ou,D.L., Yu,S.L., Tien,H.F. and Lin,L.I.
Journal Leukemia 25 (1), 32-40 (2011)
Title A copy number repeat polymorphism in the transactivation domain of the CEPBA gene is possibly associated with a protective effect against acquired CEBPA mutations: an analysis in 1135 patients with .
Author Schnittger,S., Bacher,U., Eder,C., Lohse,P., Haferlach,C., Kern,W. and Haferlach,T.
Journal Exp. Hematol. 39 (1), 87-94 (2011)
Title C/EBPalpha regulated microRNA-34a targets E2F3 during granulopoiesis and is down-regulated in AML with CEBPA mutations .
Author Pulikkan,J.A., Peramangalam,P.S., Dengler,V., Ho,P.A., Preudhomme,C., Meshinchi,S., Christopeit,M., Nibourel,O., Muller-Tidow,C., Bohlander,S.K., Tenen,D.G. and Behre,G.
Journal Blood 116 (25), 5638-5649 (2010)
Title A novel GSK-3 beta-C/EBP alpha-miR-122-insulin-like growth factor 1 receptor regulatory circuitry in human hepatocellular carcinoma .
Author Zeng,C., Wang,R., Li,D., Lin,X.J., Wei,Q.K., Yuan,Y., Wang,Q., Chen,W. and Zhuang,S.M.
Journal Hepatology 52 (5), 1702-1712 (2010)
Title Molecular cloning, sequence, and expression patterns of the human gene encoding CCAAT/enhancer binding protein alpha (C/EBP alpha) .
Author Antonson,P. and Xanthopoulos,K.G.
Journal Biochem. Biophys. Res. Commun. 215 (1), 106-113 (1995)
Title The transcription factor HNF1 acts with C/EBP alpha to synergistically activate the human albumin promoter through a novel domain .
Author Wu,K.J., Wilson,D.R., Shih,C. and Darlington,G.J.
Journal J. Biol. Chem. 269 (2), 1177-1182 (1994)
Title The CCAAT/enhancer binding protein (C/EBP alpha) gene (CEBPA) maps to human chromosome 19q13.1 and the related nuclear factor NF-IL6 (C/EBP beta) gene (CEBPB) maps to human chromosome 20q13.1 .
Author Hendricks-Taylor,L.R., Bachinski,L.L., Siciliano,M.J., Fertitta,A., Trask,B., de Jong,P.J., Ledbetter,D.H. and Darlington,G.J.
Journal Genomics 14 (1), 12-17 (1992)
Title Chromosomal localization in man and rat of the genes encoding the liver-enriched transcription factors C/EBP, DBP, and HNF1/LFB-1 (CEBP, DBP, and transcription factor 1, TCF1, respectively) and of the hepatocyte growth factor/scatter factor gene (HGF) .
Author Szpirer,C., Riviere,M., Cortese,R., Nakamura,T., Islam,M.Q., Levan,G. and Szpirer,J.
Journal Genomics 13 (2), 293-300 (1992)
Title Regulated expression of three C/EBP isoforms during adipose conversion of 3T3-L1 cells .
Author Cao,Z., Umek,R.M. and McKnight,S.L.
Journal Genes Dev. 5 (9), 1538-1552 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878