• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_004364 Homo sapiens CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_004364.3, 225735576
Length 2591 bp
Structure linear
Update Date 14-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA), mRNA.
Product CCAAT/enhancer-binding protein alpha
Comment

Summary: The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain promoters and enhancers. It can also form heterodimers with the related proteins CEBP-beta and CEBP-gamma. The encoded protein has been shown to bind to the promoter and modulate the expression of the gene encoding leptin, a protein that plays an important role in body weight homeostasis. Also, the encoded protein can interact with CDK2 and CDK4, thereby inhibiting these kinases and causing growth arrest in cultured cells. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_004355.2
CDS 111..1187
Misc Feature(1)591..593
Misc Feature(2)591..593
Misc Feature(3)591..593
Misc Feature(4)786..788
Misc Feature(5)798..800
Misc Feature(6)810..812
Misc Feature(7)951..1112
Misc Feature(8)966..1049
Misc Feature(9)1059..1145
Exon (1)1..2591
Gene:CEBPA
Gene Synonym:C/EBP-alpha; CEBP
Translation MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVM PGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP YQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPA LGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(1)-dbSNP:
complement(1)-g, adbSNP:41480346
complement(72)-t, gdbSNP:41434054
complement(178..179)-, cdbSNP:137852729
complement(178)-, cdbSNP:137852728
complement(191)-g, cdbSNP:111662895
complement(251)-, cdbSNP:137852730
complement(258)-t, gdbSNP:121912791
311..312+, ctacdbSNP:137852731
complement(327..328)-, cdbSNP:137852733
complement(361)-t, adbSNP:28931590
429..430+, tgdbSNP:137852732
complement(683)-g, adbSNP:192240793
complement(800)-t, gdbSNP:34529039
complement(823)-c, adbSNP:3745972
complement(864)-t, gdbSNP:1049967
complement(937)-t, cdbSNP:201061067
complement(1151)-t, cdbSNP:141430731
complement(1207)-c, adbSNP:148740083
complement(1332)-c, adbSNP:187751931
complement(1349)-g, adbSNP:184965384
complement(1489)-t, cdbSNP:4142943
complement(1548)-t, cdbSNP:41367646
complement(1624)-g, adbSNP:1049969
complement(1766)-g, adbSNP:192371350
complement(1782)-t, cdbSNP:2376497
complement(1902)-g, cdbSNP:707656
complement(2181)-t, adbSNP:187516157
complement(2192)-g, adbSNP:146104564
complement(2220)-t, cdbSNP:34017519
complement(2273)-g, adbSNP:113670631
complement(2304)-t, cdbSNP:12691
complement(2314)-c, adbSNP:116528776
complement(2503)-g, cdbSNP:35196724
Gene SymbolCEBPA
Gene SynonymC/EBP-alpha; CEBP
Chromosome19
Locus Map19q13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004364 Homo sapiens CCAAT/enhancer binding protein (C/EBP), alpha (CEBPA), mRNA. On-demand TBD TBD
Title Lenalidomide-mediated enhanced translation of C/EBPalpha-p30 protein up-regulates expression of the antileukemic microRNA-181a in acute myeloid leukemia .
Author Hickey,C.J., Schwind,S., Radomska,H.S., Dorrance,A.M., Santhanam,R., Mishra,A., Wu,Y.Z., Alachkar,H., Maharry,K., Nicolet,D., Mrozek,K., Walker,A., Eiring,A.M., Whitman,S.P., Becker,H., Perrotti,D., Wu,L.C., Zhao,X., Fehniger,T.A., Vij,R., Byrd,J.C., Blum,W., Lee,L.J., Caligiuri,M.A., Bloomfield,C.D., Garzon,R. and Marcucci,G.
Journal Blood 121 (1), 159-169 (2013)
Title NAD(P)H:quinone oxidoreductase 1 (NQO1) competes with 20S proteasome for binding with C/EBPalpha leading to its stabilization and protection against radiation-induced myeloproliferative disease .
Author Xu,J. and Jaiswal,A.K.
Journal J. Biol. Chem. 287 (50), 41608-41618 (2012)
Title Tet2 facilitates the derepression of myeloid target genes during CEBPalpha-induced transdifferentiation of pre-B cells .
Author Kallin,E.M., Rodriguez-Ubreva,J., Christensen,J., Cimmino,L., Aifantis,I., Helin,K., Ballestar,E. and Graf,T.
Journal Mol. Cell 48 (2), 266-276 (2012)
Title The hypoxia-inducible factor-C/EBPalpha axis controls ethanol-mediated hepcidin repression .
Author Anderson,E.R., Taylor,M., Xue,X., Martin,A., Moons,D.S., Omary,M.B. and Shah,Y.M.
Journal Mol. Cell. Biol. 32 (19), 4068-4077 (2012)
Title Up-regulation of translation eukaryotic initiation factor 4E in nucleophosmin 1 haploinsufficient cells results in changes in CCAAT enhancer-binding protein alpha activity: implications in myelodysplastic syndrome and acute myeloid leukemia .
Author Khanna-Gupta,A., Abayasekara,N., Levine,M., Sun,H., Virgilio,M., Nia,N., Halene,S., Sportoletti,P., Jeong,J.Y., Pandolfi,P.P. and Berliner,N.
Journal J. Biol. Chem. 287 (39), 32728-32737 (2012)
Title Molecular cloning, sequence, and expression patterns of the human gene encoding CCAAT/enhancer binding protein alpha (C/EBP alpha) .
Author Antonson,P. and Xanthopoulos,K.G.
Journal Biochem. Biophys. Res. Commun. 215 (1), 106-113 (1995)
Title The transcription factor HNF1 acts with C/EBP alpha to synergistically activate the human albumin promoter through a novel domain .
Author Wu,K.J., Wilson,D.R., Shih,C. and Darlington,G.J.
Journal J. Biol. Chem. 269 (2), 1177-1182 (1994)
Title The CCAAT/enhancer binding protein (C/EBP alpha) gene (CEBPA) maps to human chromosome 19q13.1 and the related nuclear factor NF-IL6 (C/EBP beta) gene (CEBPB) maps to human chromosome 20q13.1 .
Author Hendricks-Taylor,L.R., Bachinski,L.L., Siciliano,M.J., Fertitta,A., Trask,B., de Jong,P.J., Ledbetter,D.H. and Darlington,G.J.
Journal Genomics 14 (1), 12-17 (1992)
Title Chromosomal localization in man and rat of the genes encoding the liver-enriched transcription factors C/EBP, DBP, and HNF1/LFB-1 (CEBP, DBP, and transcription factor 1, TCF1, respectively) and of the hepatocyte growth factor/scatter factor gene (HGF) .
Author Szpirer,C., Riviere,M., Cortese,R., Nakamura,T., Islam,M.Q., Levan,G. and Szpirer,J.
Journal Genomics 13 (2), 293-300 (1992)
Title Regulated expression of three C/EBP isoforms during adipose conversion of 3T3-L1 cells .
Author Cao,Z., Umek,R.M. and McKnight,S.L.
Journal Genes Dev. 5 (9), 1538-1552 (1991)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.